Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.00
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Trichothiodystrophy 5, nonphotosensitive 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.7e-06
ovarian cancer 8520 7.5e-05
non primary Sjogren syndrome sicca 891 1.4e-02
ependymoma 4679 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Panhypopituitarism 14 3.483 1.7
Disease Target Count
Photosensitive trichothiodystrophy 30

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 1.7e-02
non primary Sjogren syndrome sicca 1.100 1.4e-02
osteosarcoma -1.552 2.7e-06
ovarian cancer 1.200 7.5e-05

Synonym

Accession O15541 B2RBR7
Symbols TTD5
Cwc24
RNF113
ZNF183

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKT      1 - 70
RDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKI     71 - 140
QEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGF    141 - 210
CGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHY    211 - 280
FCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT           281 - 343
//

Text Mined References (18)

PMID Year Title