Property Summary

NCBI Gene PubMed Count 58
PubMed Score 158.46
PubTator Score 95.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.100 5.8e-04
astrocytic glioma -1.800 3.4e-02
Astrocytoma, Pilocytic 2.500 2.6e-05
Atopic dermatitis -2.700 2.3e-03
atypical teratoid / rhabdoid tumor 1.100 2.3e-02
Breast cancer -2.000 3.7e-03
breast carcinoma -1.200 7.8e-07
cutaneous lupus erythematosus -3.100 8.0e-04
glioblastoma 1.800 1.5e-03
group 3 medulloblastoma -2.000 4.0e-02
medulloblastoma, large-cell -4.600 9.6e-06
non primary Sjogren syndrome sicca 1.100 1.6e-02
pituitary cancer -1.700 1.9e-03
psoriasis -2.200 4.3e-03
severe Alzheimer's disease -1.049 4.9e-02

 GWAS Trait (1)

Gene RIF (44)

AA Sequence

MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE      1 - 70
FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA             71 - 132
//

Text Mined References (59)

PMID Year Title