Property Summary

NCBI Gene PubMed Count 56
Grant Count 71
R01 Count 29
Funding $16,105,259.34
PubMed Score 144.99
PubTator Score 95.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.100 0.014
psoriasis -2.600 0.000
cutaneous lupus erythematosus -3.500 0.003
glioblastoma 1.800 0.001
atypical teratoid/rhabdoid tumor 1.200 0.001
medulloblastoma, large-cell -4.600 0.000
Atopic dermatitis -2.700 0.002
pediatric high grade glioma 1.700 0.029
group 3 medulloblastoma -2.000 0.040
pilocytic astrocytoma 2.600 0.000
non primary Sjogren syndrome sicca 1.100 0.016
severe Alzheimer's disease -1.049 0.049
breast carcinoma -1.200 0.000
Breast cancer -3.500 0.000
pituitary cancer -2.800 0.001

Synonym

Accession O15540 B2R4L1 O14951 Q6IAU7 Q9H047
Symbols MRG
BLBP
FABPB
B-FABP

Gene

PDB

1FDQ   1FE3   1JJX  

Gene RIF (42)

PMID Text
25389781 FABP7 and HMGCS2 may have roles in apocrine differentiation categorizing apocrine carcinoma of the breast
25192834 FABP7 is overexpressed in clear cell renal cell carcinoma and promotes cell growth by the activation of ERK and Stat3 signaling pathways
25114248 identified 98 transposable element-FABP7 gene chimeric transcripts that were exclusively expressed in primary diffuse large B-cell lymphoma (DLBCL) cases and confirmed several in DLBCL-derived cell lines
25027319 The frameshift and missense mutations in FABP3, FABP5, and FABP7 genes have been identified in schizophrenia and autism spectrum disorder in humans and in mouse behavioral studies.
24966941 The mRNA/protein expressions of FABP7 was lower in the stenotic colon segment tissue than in the normal colon segment tissue of Hirschsrung disease patients.
24932636 These results suggest an important role of Rev-erbalpha and Fabp7 in adult neurogenesis.
24274717 Our data introduces FABP7 as a marker for glioma stem cells and further highlights its possible significance for glioma diagnosis and treatment.
24114376 FABP7 and FABP5 are differentially expressed in oligodendrocyte lineage cells and regulate their proliferation and/or differentiation.
23284888 FABP7 is almost exclusively expressed in neurospheres and not in the adherent cells, derived from the same glioblastoma tumor.
23020859 Report feasibility of detecting B-FABP as biomarker for ischemic brain damage during extrcorporeal circulation in coronary artery bypass grafting patients.
More...

AA Sequence

MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE      1 - 70
FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA             71 - 132
//

Text Mined References (57)

PMID Year Title
25785516 2015 Human endogenous retrovirus group E and its involvement in diseases.
25389781 2014 FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast.
25192834 2015 Overexpression of FABP7 promotes cell growth and predicts poor prognosis of clear cell renal cell carcinoma.
25114248 2014 Distinct isoform of FABP7 revealed by screening for retroelement-activated genes in diffuse large B-cell lymphoma.
25027319 2014 Functional characterization of FABP3, 5 and 7 gene variants identified in schizophrenia and autism spectrum disorder and mouse behavioral studies.
24966941 2014 Differential expressions of BMPR1?, ACTN4? and FABP7 in Hirschsprung disease.
24932636 2014 The nuclear receptor REV-ERB? regulates Fabp7 and modulates adult hippocampal neurogenesis.
24274717 2013 Fatty acid binding protein 7 as a marker of glioma stem cells.
24114376 2013 Differential expression and regulatory roles of FABP5 and FABP7 in oligodendrocyte lineage cells.
23284888 2012 A radial glia gene marker, fatty acid binding protein 7 (FABP7), is involved in proliferation and invasion of glioblastoma cells.
More...