Property Summary

NCBI Gene PubMed Count 54
PubMed Score 49.28
PubTator Score 52.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Benign paroxysmal positional nystagmus 11 3.053 1.5

Expression

  Differential Expression (36)

Disease log2 FC p
acute myeloid leukemia -1.700 4.7e-02
adult high grade glioma -1.700 3.7e-03
aldosterone-producing adenoma -1.805 3.4e-02
astrocytic glioma -1.200 2.5e-02
atypical teratoid / rhabdoid tumor 1.500 1.4e-09
breast carcinoma -1.100 1.3e-12
colon cancer -1.500 4.8e-02
cystic fibrosis and chronic rhinosinusit... 1.005 2.5e-02
dermatomyositis -1.500 2.3e-03
Down syndrome 1.200 1.8e-02
glioblastoma -2.000 6.1e-03
group 3 medulloblastoma 1.400 4.0e-03
group 4 medulloblastoma -1.200 1.5e-02
interstitial cystitis 1.300 3.0e-03
intraductal papillary-mucinous adenoma (... -2.500 1.6e-02
intraductal papillary-mucinous carcinoma... -1.700 2.6e-02
intraductal papillary-mucinous neoplasm ... -3.900 3.0e-03
invasive ductal carcinoma -1.100 7.0e-04
lung adenocarcinoma -1.100 2.1e-06
lung cancer -1.200 1.7e-03
lung carcinoma 2.000 7.3e-13
medulloblastoma, large-cell -1.700 4.2e-03
non-small cell lung cancer -1.064 2.3e-06
osteosarcoma 2.530 5.5e-03
ovarian cancer -2.700 5.4e-06
pancreatic cancer 1.300 9.9e-03
pituitary cancer 2.500 1.6e-03
posterior fossa group B ependymoma 1.500 1.9e-06
primary pancreatic ductal adenocarcinoma 1.260 4.5e-02
primary Sjogren syndrome 1.400 2.0e-03
primitive neuroectodermal tumor 1.200 2.5e-04
psoriasis 1.600 1.1e-02
pterygium 2.000 1.2e-03
type 2 diabetes -1.055 6.6e-03
ulcerative colitis 2.100 9.2e-05
urothelial carcinoma 3.100 4.5e-05

Protein-protein Interaction (2)

Gene RIF (38)

AA Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ      1 - 70
NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM     71 - 140
KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK                                 141 - 181
//

Text Mined References (55)

PMID Year Title