Property Summary

NCBI Gene PubMed Count 52
Grant Count 45
R01 Count 25
Funding $2,689,531.32
PubMed Score 47.50
PubTator Score 52.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (36)

PMID Text
26782409 The rs16849802 of RGS5 and haplotype GAA independently increased the risk of essential hypertension in Mongolian patients, and may be used as a risk factor for the prediction of high blood pressure.
26663397 Downregulation of RGS5 is an important prerequisite for smooth muscle cell proliferation in vascular injury model.
26558691 The pericyte marker RGS5 may be of future clinical utility for the evaluation of pericytic differentiation in soft tissue tumors.
25891540 RGS5 enhanced the cytotoxic effect of radiation in the human lung cancer cells. Our results indicated that RGS5 may be a potential target for cancer therapy.
24297163 ectopic expression of R4 subfamily members RGS2, RGS3, RGS4, and RGS5 reduced activated PAR1 wild-type signaling, whereas signaling by the PAR1 AKKAA mutant was minimally affected.
23868206 Over-expression of regulator of G protein signaling 5 promotes tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma cells.
23464602 RGS1 is largely upregulated, whereas RGS2 is downregulated in the majority of solid tumors, whereas RGS5 transcripts are greatly increased in eight subtypes of lymphoma with no reports of downregulation in hematological malignancies
23193110 Our work identifies a new genetic variant in RGS5 demonstrating additive effect with PDE4D, both implicated in modulation of asthma treatment.
22130514 demonstrate RGS5 in the blood vessels of other cancer models endowed with a proangiogenic environment, such as human melanoma and renal carcinoma xenografts
21881522 examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-Americans
More...

AA Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ      1 - 70
NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM     71 - 140
KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK                                 141 - 181
//

Text Mined References (53)

PMID Year Title
26782409 2015 Association of regulator of G protein signaling (RGS5) gene variants and essential hypertension in Mongolian and Han populations.
26663397 2016 Regulator of G-Protein Signaling 5 Prevents Smooth Muscle Cell Proliferation and Attenuates Neointima Formation.
26558691 2016 The pericyte antigen RGS5 in perivascular soft tissue tumors.
25891540 2015 Overexpression of the regulator of G-protein signaling 5 reduces the survival rate and enhances the radiation response of human lung cancer cells.
24297163 2014 Regulation of protease-activated receptor 1 signaling by the adaptor protein complex 2 and R4 subfamily of regulator of G protein signaling proteins.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24009623 2013 Genome-wide association study for biomarker identification of Rapamycin and Everolimus using a lymphoblastoid cell line system.
23868206 2013 Over-expression of regulator of G protein signaling 5 promotes tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma cells.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23193110 2013 RGS5 gene and therapeutic response to short acting bronchodilators in paediatric asthma patients.
More...