Property Summary

NCBI Gene PubMed Count 52
PubMed Score 47.50
PubTator Score 52.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 7.33291422523498E-13
breast carcinoma 1614 1.33211649868905E-12
non-small cell lung cancer 2798 2.35501030448652E-10
atypical teratoid / rhabdoid tumor 4369 1.43318878789814E-9
ulcerative colitis 2087 1.617086710438E-7
ovarian cancer 8492 3.55535122728971E-7
lung adenocarcinoma 2714 4.44837895943226E-7
urothelial carcinoma 318 1.66939953579834E-6
posterior fossa group B ependymoma 1530 1.88998588558426E-6
medulloblastoma 1524 2.23612766116929E-6
lung cancer 4473 4.09354653855398E-6
medulloblastoma, large-cell 6234 5.7275405443184E-6
invasive ductal carcinoma 2950 2.943160320048E-5
primitive neuroectodermal tumor 3031 2.54053818524382E-4
pterygium 74 0.00121462790984439
pituitary cancer 1972 0.00164641302343603
glioblastoma 5572 0.00184560015272393
primary Sjogren syndrome 789 0.00204292453853469
dermatomyositis 967 0.00233391373621136
osteosarcoma 7933 0.002660203267932
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00284261511190935
interstitial cystitis 2299 0.00296912489641442
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00304528425458711
adult high grade glioma 2148 0.00370788358947408
type 2 diabetes 8 0.0066311817638501
astrocytic glioma 2241 0.00753096552753341
pancreatic cancer 2300 0.00987421177619593
psoriasis 6685 0.0110097265478736
group 4 medulloblastoma 1875 0.0151202078407925
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0155712681036697
Down syndrome 548 0.0178763625273387
cystic fibrosis and chronic rhinosinusitis 213 0.01824705120998
colon cancer 1475 0.0276404274993129
aldosterone-producing adenoma 664 0.0339159949456223
primary pancreatic ductal adenocarcinoma 1271 0.0450109156491476
acute myeloid leukemia 785 0.047268661574794
Disease Target Count Z-score Confidence
Benign paroxysmal positional nystagmus 13 3.177 1.6

Expression

Synonym

Accession O15539 E9PMP5 Q53XA9 Q599J0 RGS5
Symbols MST092
MST106
MST129
MSTP032
MSTP092
MSTP106
MSTP129

Gene

PANTHER Protein Class (2)

PDB

2CRP  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (36)

PMID Text
26782409 The rs16849802 of RGS5 and haplotype GAA independently increased the risk of essential hypertension in Mongolian patients, and may be used as a risk factor for the prediction of high blood pressure.
26663397 Downregulation of RGS5 is an important prerequisite for smooth muscle cell proliferation in vascular injury model.
26558691 The pericyte marker RGS5 may be of future clinical utility for the evaluation of pericytic differentiation in soft tissue tumors.
25891540 RGS5 enhanced the cytotoxic effect of radiation in the human lung cancer cells. Our results indicated that RGS5 may be a potential target for cancer therapy.
24297163 ectopic expression of R4 subfamily members RGS2, RGS3, RGS4, and RGS5 reduced activated PAR1 wild-type signaling, whereas signaling by the PAR1 AKKAA mutant was minimally affected.
23868206 Over-expression of regulator of G protein signaling 5 promotes tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma cells.
23464602 RGS1 is largely upregulated, whereas RGS2 is downregulated in the majority of solid tumors, whereas RGS5 transcripts are greatly increased in eight subtypes of lymphoma with no reports of downregulation in hematological malignancies
23193110 Our work identifies a new genetic variant in RGS5 demonstrating additive effect with PDE4D, both implicated in modulation of asthma treatment.
22130514 demonstrate RGS5 in the blood vessels of other cancer models endowed with a proangiogenic environment, such as human melanoma and renal carcinoma xenografts
21881522 examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-Americans
More...

AA Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ      1 - 70
NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM     71 - 140
KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK                                 141 - 181
//

Text Mined References (53)

PMID Year Title
26782409 2015 Association of regulator of G protein signaling (RGS5) gene variants and essential hypertension in Mongolian and Han populations.
26663397 2016 Regulator of G-Protein Signaling 5 Prevents Smooth Muscle Cell Proliferation and Attenuates Neointima Formation.
26558691 2016 The pericyte antigen RGS5 in perivascular soft tissue tumors.
25891540 2015 Overexpression of the regulator of G-protein signaling 5 reduces the survival rate and enhances the radiation response of human lung cancer cells.
24297163 2014 Regulation of protease-activated receptor 1 signaling by the adaptor protein complex 2 and R4 subfamily of regulator of G protein signaling proteins.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24009623 2013 Genome-wide association study for biomarker identification of Rapamycin and Everolimus using a lymphoblastoid cell line system.
23868206 2013 Over-expression of regulator of G protein signaling 5 promotes tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma cells.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23193110 2013 RGS5 gene and therapeutic response to short acting bronchodilators in paediatric asthma patients.
More...