Property Summary

NCBI Gene PubMed Count 54
PubMed Score 49.28
PubTator Score 52.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Benign paroxysmal positional nystagmus 11 3.053 1.5

Expression

  Differential Expression (36)

Disease log2 FC p
acute myeloid leukemia -1.700 4.7e-02
adult high grade glioma -1.700 3.7e-03
aldosterone-producing adenoma -1.805 3.4e-02
astrocytic glioma -1.200 2.5e-02
atypical teratoid / rhabdoid tumor 1.500 1.4e-09
breast carcinoma -1.100 1.3e-12
colon cancer -1.500 4.8e-02
cystic fibrosis and chronic rhinosinusit... 1.005 2.5e-02
dermatomyositis -1.500 2.3e-03
Down syndrome 1.200 1.8e-02
glioblastoma -2.000 6.1e-03
group 3 medulloblastoma 1.400 4.0e-03
group 4 medulloblastoma -1.200 1.5e-02
interstitial cystitis 1.300 3.0e-03
intraductal papillary-mucinous adenoma (... -2.500 1.6e-02
intraductal papillary-mucinous carcinoma... -1.700 2.6e-02
intraductal papillary-mucinous neoplasm ... -3.900 3.0e-03
invasive ductal carcinoma -1.100 7.0e-04
lung adenocarcinoma -1.100 2.1e-06
lung cancer -1.200 1.7e-03
lung carcinoma 2.000 7.3e-13
medulloblastoma, large-cell -1.700 4.2e-03
non-small cell lung cancer -1.064 2.3e-06
osteosarcoma 2.530 5.5e-03
ovarian cancer -2.700 5.4e-06
pancreatic cancer 1.300 9.9e-03
pituitary cancer 2.500 1.6e-03
posterior fossa group B ependymoma 1.500 1.9e-06
primary pancreatic ductal adenocarcinoma 1.260 4.5e-02
primary Sjogren syndrome 1.400 2.0e-03
primitive neuroectodermal tumor 1.200 2.5e-04
psoriasis 1.600 1.1e-02
pterygium 2.000 1.2e-03
type 2 diabetes -1.055 6.6e-03
ulcerative colitis 2.100 9.2e-05
urothelial carcinoma 3.100 4.5e-05

Synonym

Accession O15539 E9PMP5 Q53XA9 Q599J0 RGS5
Symbols MST092
MST106
MST129
MSTP032
MSTP092
MSTP106
MSTP129

Gene

PANTHER Protein Class (2)

PDB

2CRP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (38)

AA Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ      1 - 70
NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM     71 - 140
KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK                                 141 - 181
//

Text Mined References (55)

PMID Year Title