Property Summary

NCBI Gene PubMed Count 77
PubMed Score 131.27
PubTator Score 406.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.500 3.6e-31
lung cancer -1.500 5.2e-03
osteosarcoma -1.019 1.7e-07

Gene RIF (64)

AA Sequence

MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLG      1 - 70
FESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQG     71 - 140
RCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRI    141 - 210
AIRMELLECVSKCA                                                            211 - 224
//

Text Mined References (79)

PMID Year Title