Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.85
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.300 3.3e-04
Astrocytoma, Pilocytic 1.100 9.1e-06
atypical teratoid / rhabdoid tumor 1.700 6.3e-10
glioblastoma 1.300 9.9e-06
group 3 medulloblastoma 2.000 2.9e-05
lung cancer 1.300 8.3e-03
medulloblastoma, large-cell 1.600 1.2e-05
primitive neuroectodermal tumor 1.400 2.7e-03

AA Sequence

MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCYQETPGPREAL      1 - 70
TRLQELCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESGEEAVILLEDLERELDEPQHE     71 - 140
MVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGETDEVTKTEDRELVLRKDCPKIV    141 - 210
EPHGKMFNEQTWEVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGER    211 - 280
PYECNECGKAFSRSSGLFNHRGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRR    281 - 350
SFLIEHQRSHTGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV                              351 - 394
//

Text Mined References (11)

PMID Year Title