Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.85
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.500 0.000
lung cancer 1.300 0.008
adult high grade glioma 1.300 0.000
pilocytic astrocytoma 1.100 0.000

AA Sequence

MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCYQETPGPREAL      1 - 70
TRLQELCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESGEEAVILLEDLERELDEPQHE     71 - 140
MVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGETDEVTKTEDRELVLRKDCPKIV    141 - 210
EPHGKMFNEQTWEVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGER    211 - 280
PYECNECGKAFSRSSGLFNHRGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRR    281 - 350
SFLIEHQRSHTGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV                              351 - 394
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24658003 2014 TDP2 protects transcription from abortive topoisomerase activity and is required for normal neural function.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10567577 1999 The zinc finger-associated SCAN box is a conserved oligomerization domain.
9244436 1997 Three genes encoding zinc finger proteins on human chromosome 6p21.3: members of a new subclass of the Kruppel gene family containing the conserved SCAN box domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.