Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.85
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 6.265450649164E-10
glioblastoma 5572 9.88345533821673E-6
medulloblastoma, large-cell 6234 1.19502925610113E-5
pilocytic astrocytoma 3086 1.26943014570047E-5
primitive neuroectodermal tumor 3031 1.34243496127567E-5
group 3 medulloblastoma 2254 2.87885098473605E-5
adult high grade glioma 2148 3.30870920258203E-4
lung cancer 4473 0.00830867212039265
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.500 0.000
lung cancer 1.300 0.008
adult high grade glioma 1.300 0.000
pilocytic astrocytoma 1.100 0.000

Synonym

Accession O15535 B4E1W6 E7EVQ2 Q2TTR1
Symbols PRD51
ZNF193

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

AA Sequence

MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCYQETPGPREAL      1 - 70
TRLQELCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESGEEAVILLEDLERELDEPQHE     71 - 140
MVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGETDEVTKTEDRELVLRKDCPKIV    141 - 210
EPHGKMFNEQTWEVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGER    211 - 280
PYECNECGKAFSRSSGLFNHRGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRR    281 - 350
SFLIEHQRSHTGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV                              351 - 394
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24658003 2014 TDP2 protects transcription from abortive topoisomerase activity and is required for normal neural function.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10567577 1999 The zinc finger-associated SCAN box is a conserved oligomerization domain.
9244436 1997 Three genes encoding zinc finger proteins on human chromosome 6p21.3: members of a new subclass of the Kruppel gene family containing the conserved SCAN box domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.