Property Summary

NCBI Gene PubMed Count 102
Grant Count 178
R01 Count 115
Funding $21,569,435.46
PubMed Score 61.17
PubTator Score 1637.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma -1.500 0.003
interstitial lung disease -1.400 0.045
urothelial carcinoma -1.100 0.000
malignant mesothelioma 1.800 0.000
ependymoma 1.100 0.023
group 4 medulloblastoma -1.400 0.000
adrenocortical carcinoma -1.031 0.000
non-small cell lung cancer -1.268 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.019
lung cancer -2.000 0.000
colon cancer -1.100 0.002
sarcoidosis -1.100 0.040
breast carcinoma -1.500 0.000
Breast cancer -2.400 0.027
lung adenocarcinoma -2.300 0.000
psoriasis -2.100 0.000
ductal carcinoma in situ -2.000 0.001
invasive ductal carcinoma -2.100 0.001

Synonym

Accession O15534 B2RPA8 B4DI49 D3DTR3 hPER1
Symbols PER
hPER
RIGUI

Gene

PDB

1UL6  

 GO Component (2)

Gene RIF (82)

PMID Text
26850841 when overexpressed, c-MYC is able to repress Per1 transactivation by BMAL1/CLOCK via targeting selective E-box sequences. Importantly, upon serum stimulation, MYC was detected in BMAL1 protein complexes
26624862 The PER1 c.2884C > G polymorphism and PER3 54bp VNTR were associated with annual percent changes in bone mineral density of femoral neck after 1 year of hormone therapy. PER1 c.2884C > G polymorphism may be associated with risk of non-response to HT in postmenopausal Korean women.
26507264 ARNTL and PER1 were associated with PD.
26377793 Data demonstrate a role for Per1 in the transcriptional regulation of NHE3 and SGLT1 in the kidney.
26339386 Period 1 and estrogen receptor-beta are downregulated in Chinese colon cancers.
26319354 Collectively, these data show that KPNB1 is required for timely nuclear import of PER/CRY in the negative feedback regulation of the circadian clock.
26168277 In adipose tissue, acute sleep deprivation vs sleep increased methylation in two promoter-interacting enhancer regions of PER1
25863084 Fourteen proteins were identified to interact with per1 in tumor.
25550826 In patients with non-small cell lung cancer, loss of Per1 was correlated with poor differentiation, tumor status, high p-TNM stage and lymph node metastasis. Patients with lower expression of Per1, Per2 and Per3 had a shorter survival time.
25344870 Functional SNPs found in PER1 were significantly associated with recurrence-free survival in a Chinese population with hepatocellular carcinoma.
More...

AA Sequence

MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSS      1 - 70
HSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMT     71 - 140
ALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCSMDMSTYTLEELEHITS    141 - 210
EYTLQNQDTFSVAVSFLTGRIVYISEQAAVLLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGT    211 - 280
GASAGSGLRDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEA    281 - 350
PRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF    351 - 420
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDTDIQELS    421 - 490
EQIHRLLLQPVHSPSPTGLCGVGAVTSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLVKHQG    491 - 560
QQLFIESRARPQSRPRLPATGTFKAKALPCQSPDPELEAGSAPVQAPLALVPEEAERKEASSCSYQQINC    561 - 630
LDSILRYLESCNLPSTTKRKCASSSSYTTSSASDDDRQRTGPVSVGTKKDPPSAALSGEGATPRKEPVVG    631 - 700
GTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAP    701 - 770
DAYRPVGLTKAVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPPSRRHHCRSKAK    771 - 840
RSRHHQNPRAEAPCYVSHPSPVPPSTPWPTPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPTSVPPAAF    841 - 910
PAPLVTPMVALVLPNYLFPTPSSYPYGALQTPAEGPPTPASHSPSPSLPALAPSPPHRPDSPLFNSRCSS    911 - 980
PLQLNLLQLEELPRAEGAAVAGGPGSSAGPPPPSAEAAEPEARLAEVTESSNQDALSGSSDLLELLLQED    981 - 1050
SRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSIDSSEAEAGAARGGAEPGDQ   1051 - 1120
VIKYVLQDPIWLLMANADQRVMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRK   1121 - 1190
GQLPRALDVMACVDCGSSTQDPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAQGGAKA   1191 - 1260
SSSQDLAMEEEEEGRSSSSPALPTAGNCTS                                           1261 - 1290
//

Text Mined References (114)

PMID Year Title
26850841 2016 c-MYC targets the central oscillator gene Per1 and is regulated by the circadian clock at the post-transcriptional level.
26624862 2016 Polymorphisms in period genes and bone response to hormone therapy in postmenopausal Korean women.
26507264 2015 Association of ARNTL and PER1 genes with Parkinson's disease: a case-control study of Han Chinese.
26377793 2015 Transcriptional regulation of NHE3 and SGLT1 by the circadian clock protein Per1 in proximal tubule cells.
26339386 2015 Period 1 and estrogen receptor-beta are downregulated in Chinese colon cancers.
26319354 2015 KPNB1 mediates PER/CRY nuclear translocation and circadian clock function.
26168277 2015 Acute Sleep Loss Induces Tissue-Specific Epigenetic and Transcriptional Alterations to Circadian Clock Genes in Men.
25863084 2015 [Identification of proteins interacting with the circadian clock protein PER1 in tumors using bacterial two-hybrid system technique].
25550826 2014 Aberrant expression of Per1, Per2 and Per3 and their prognostic relevance in non-small cell lung cancer.
25344870 2014 Functional polymorphisms of circadian negative feedback regulation genes are associated with clinical outcome in hepatocellular carcinoma patients receiving radical resection.
More...