Property Summary

NCBI Gene PubMed Count 87
PubMed Score 398.10
PubTator Score 66.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.200 3.0e-02
astrocytoma 1.900 2.0e-03
Atopic dermatitis 1.400 1.6e-05
COPD -1.200 4.7e-03
ependymoma 1.200 5.7e-03
esophageal adenocarcinoma 1.200 1.8e-02
glioblastoma 1.300 3.4e-03
intraductal papillary-mucinous carcinoma... 1.100 2.4e-02
juvenile dermatomyositis 1.486 9.9e-11
lung cancer -1.300 1.1e-03
oligodendroglioma 1.300 1.7e-03
osteosarcoma 1.081 8.4e-05
ovarian cancer 2.800 4.0e-07
psoriasis -1.600 2.1e-04

Gene RIF (55)

AA Sequence

MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHD      1 - 70
PAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLR     71 - 140
PQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQH    141 - 210
LGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQG    211 - 280
QVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLS    281 - 350
ALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA    351 - 420
FLLLGLFKALGWAAVYLSTCKDSKKKAE                                              421 - 448
//

Text Mined References (90)

PMID Year Title