Property Summary

NCBI Gene PubMed Count 83
Grant Count 95
R01 Count 69
Funding $6,673,250.33
PubMed Score 373.58
PubTator Score 66.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 1.200 0.006
oligodendroglioma 1.300 0.002
esophageal adenocarcinoma 1.200 0.018
psoriasis -1.600 0.000
osteosarcoma -2.319 0.000
astrocytoma 1.900 0.002
glioblastoma 1.300 0.003
juvenile dermatomyositis 1.486 0.000
Atopic dermatitis 1.400 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.024
lung cancer -2.300 0.000
COPD -1.200 0.005
acute myeloid leukemia 1.600 0.034
ovarian cancer 2.800 0.000

Gene

PDB

3F8U  

Gene RIF (51)

PMID Text
26519531 TAP/TPN complex formation is driven by hydrophobic interactions via leucine zipper-like motifs.
26416272 Data suggest that tapasin (Tsn) binds to MHC I with suboptimal cargo and thereby adjusts the energy landscape in favor of MHC I complexes with immunodominant epitopes.
26310568 reduction in tapasin expression is associated with tumor progression in colorectal cancer
25874709 TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population
25175688 Analysis of expression of tapasin and/or HLA-I may be of value as prognostic tool for glioblastoma multiforme patients, especially when considering immunotherapy.
24163410 the data indicate that TAPBPR and tapasin bind in a similar orientation to the same face of MHC class I.
23940558 Targeted re-sequencing identified rs3106189 at the 5' UTR of TAPBP and rs1052918 at the 3' UTR of TCF3 to be associated with the overall survival of colorectal cancer patients.
23736108 TAPBP polymorphisms may play a role in the development of aspirin-exacerbated respiratory disease.
23640800 Modified TAPBP gene function may contribute to the development of refractory chronic rhinosinusitis via reduction of circulating CD8 lymphocytes.
23519916 isoform lacking exon 3 affects MHC class I-peptide binding
More...

AA Sequence

MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHD      1 - 70
PAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLR     71 - 140
PQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQH    141 - 210
LGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQG    211 - 280
QVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLS    281 - 350
ALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA    351 - 420
FLLLGLFKALGWAAVYLSTCKDSKKKAE                                              421 - 448
//

Text Mined References (86)

PMID Year Title
26519531 2015 Hydrophobic Interactions Are Key To Drive the Association of Tapasin with Peptide Transporter Subunit TAP2.
26416272 2015 Mechanistic Basis for Epitope Proofreading in the Peptide-Loading Complex.
26310568 2015 Loss of tapasin correlates with diminished CD8(+) T-cell immunity and prognosis in colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25874709 2015 Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.
25175688 2014 Tapasin and human leukocyte antigen class I dysregulation correlates with survival in glioblastoma multiforme.
24163410 2013 The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive.
23940558 2013 Targeted re-sequencing identified rs3106189 at the 5' UTR of TAPBP and rs1052918 at the 3' UTR of TCF3 to be associated with the overall survival of colorectal cancer patients.
23736108 2013 Association analysis of tapasin polymorphisms with aspirin-exacerbated respiratory disease in asthmatics.
23640800 2013 CD8A gene polymorphisms predict severity factors in chronic rhinosinusitis.
More...