Property Summary

NCBI Gene PubMed Count 185
Grant Count 32
R01 Count 20
Funding $2,192,863.54
PubMed Score 191.53
PubTator Score 53.11

Knowledge Summary

Patent (86,102)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 0.017
ependymoma -1.600 0.036
osteosarcoma 1.098 0.000
glioblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma -1.500 0.002
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.200 0.016
adult high grade glioma -2.400 0.000
pilocytic astrocytoma -1.500 0.001
subependymal giant cell astrocytoma -1.097 0.021
ovarian cancer 2.300 0.000

Synonym

Accession O15530 H0Y4Z0 Q59EH6 Q6FI20 Q8IV52 Q9BRD5 hPDK1
Symbols PDK1
PDPK2
PDPK2P
PRO0461

Gene

PDB

1H1W   1OKY   1OKZ   1UU3   1UU7   1UU8   1UU9   1UVR   1W1D   1W1G   1W1H   1Z5M   2BIY   2PE0   2PE1   2PE2   2R7B   2VKI   2XCH   2XCK   3H9O   3HRC   3HRF   3ION   3IOP   3NAX   3NAY   3NUN   3NUS   3NUU   3NUY   3ORX   3ORZ   3OTU   3PWY   3QC4   3QCQ   3QCS   3QCX   3QCY   3QD0   3QD3   3QD4   3RCJ   3RWP   3RWQ   3SC1   4A06   4A07   4AW0   4AW1   4CT1   4CT2   4RQK   4RQV   4RRV   4XX9   5ACK   5HKM   5HNG   5HO7   5HO8  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (102)

PMID Text
26919807 Data suggest that claudin-18 suppresses the abnormal proliferation and motility of lung epithelial cells mediated by inhibition of phosphorylation of phosphoinositide-dependent protein kinase-1 and proto-oncogene protein c-akt (Akt).
26684827 PGE2 increases normal bronchial epithelial cell proliferation through increased PDK1 gene expression that is dependent on EP4 and induction of c-Jun.
26553931 AMIGO2 is an important regulator of the PDK1-Akt pathway.
26504072 Low PDK1 expression is associated with Ovarian Serous Carcinoma.
26487493 Dephosphorylation of PDK-1 and the resulting changes to Akt phosphorylation is one of the mechanisms by which infection with Helicobacter pylori alter the balance between apoptosis and cell proliferation.
26432169 DK1 inhibits the formation of the TAK1-TAB2-TRAF6 complex and leads to the inhibition of TRAF6 ubiquitination.
26318166 PDK1 functions as a tumor promoter in human gallbladder cancer by upregulating JunB, promoting epithelial mesenchymal transformation, and cell migration.
26297548 miR-454 functions as a tumor suppressor in glioblastoma, inhibiting proliferation of human glioblastoma cells by suppressing PDK1 expression.
26294745 Data show that NSC156529 inhibits the interaction of endogenous serine/threonine kinase AKT (AKT1) and 3-phosphoinositide dependent protein kinase-1 (PDPK1) proteins.
26238471 Altogether, these findings indicate the possibility to rationally target PDK1 in human tumors in order to counteract cancer cell dissemination in the organism.
More...

AA Sequence

MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRPGAGSLQHAQP      1 - 70
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHP     71 - 140
FFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPEN    141 - 210
ILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLP    211 - 280
PFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL    281 - 350
HQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD    351 - 420
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPV    421 - 490
NKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ        491 - 556
//

Text Mined References (196)

PMID Year Title
26919807 2016 Claudin-18 inhibits cell proliferation and motility mediated by inhibition of phosphorylation of PDK1 and Akt in human lung adenocarcinoma A549 cells.
26684827 2015 Prostaglandin E2 stimulates normal bronchial epithelial cell growth through induction of c-Jun and PDK1, a kinase implicated in oncogenesis.
26553931 2015 AMIGO2, a novel membrane anchor of PDK1, controls cell survival and angiogenesis via Akt activation.
26504072 2015 PDK1 is Expressed in Ovarian Serous Carcinoma and Correlates with Improved Survival in High-grade Tumors.
26487493 2015 Helicobacter pylori modulates host cell survival regulation through the serine-threonine kinase, 3-phosphoinositide dependent kinase 1 (PDK-1).
26432169 2015 Phosphoinositide-dependent kinase-1 inhibits TRAF6 ubiquitination by interrupting the formation of TAK1-TAB2 complex in TLR4 signaling.
26318166 2015 PDK1 induces JunB, EMT, cell migration and invasion in human gallbladder cancer.
26297548 2015 MiR-454 inhibited cell proliferation of human glioblastoma cells by suppressing PDK1 expression.
26294745 2015 A Novel Inhibitor of AKT1-PDPK1 Interaction Efficiently Suppresses the Activity of AKT Pathway and Restricts Tumor Growth In Vivo.
26238471 2015 PDK1: A signaling hub for cell migration and tumor invasion.
More...