Property Summary

Ligand Count 263
NCBI Gene PubMed Count 194
PubMed Score 204.92
PubTator Score 53.11

Knowledge Summary

Patent (86,102)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.400 7.1e-06
astrocytic glioma -1.400 1.7e-02
Astrocytoma, Pilocytic -1.500 1.1e-03
atypical teratoid / rhabdoid tumor -2.400 2.5e-06
ependymoma -1.600 3.6e-02
glioblastoma -1.500 1.9e-04
group 4 medulloblastoma -1.400 1.2e-02
medulloblastoma, large-cell -2.600 1.5e-05
osteosarcoma -1.084 5.1e-06
ovarian cancer -1.200 5.0e-06
primitive neuroectodermal tumor -1.200 1.6e-02
subependymal giant cell astrocytoma -1.097 2.1e-02

Synonym

Accession O15530 H0Y4Z0 Q59EH6 Q6FI20 Q8IV52 Q9BRD5 hPDK1
Symbols PDK1
PDPK2
PDPK2P
PRO0461

Gene

PDB

1H1W   1OKY   1OKZ   1UU3   1UU7   1UU8   1UU9   1UVR   1W1D   1W1G   1W1H   1Z5M   2BIY   2PE0   2PE1   2PE2   2R7B   2VKI   2XCH   2XCK   3H9O   3HRC   3HRF   3ION   3IOP   3NAX   3NAY   3NUN   3NUS   3NUU   3NUY   3ORX   3ORZ   3OTU   3PWY   3QC4   3QCQ   3QCS   3QCX   3QCY   3QD0   3QD3   3QD4   3RCJ   3RWP   3RWQ   3SC1   4A06   4A07   4AW0   4AW1   4CT1   4CT2   4RQK   4RQV   4RRV   4XX9   5ACK   5HKM   5HNG   5HO7   5HO8   5LVL   5LVM   5LVN   5LVO   5LVP   5MRD  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (109)

AA Sequence

MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRPGAGSLQHAQP      1 - 70
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHP     71 - 140
FFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPEN    141 - 210
ILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLP    211 - 280
PFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL    281 - 350
HQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD    351 - 420
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPV    421 - 490
NKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ        491 - 556
//

Text Mined References (205)

PMID Year Title