Property Summary

Ligand Count 3
NCBI Gene PubMed Count 165
PubMed Score 492.95
PubTator Score 377.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 3.488 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 2.300 5.0e-05
glioblastoma 1.100 1.8e-02
invasive ductal carcinoma 1.100 2.5e-04
malignant mesothelioma 3.800 9.4e-09
medulloblastoma, large-cell 1.400 1.0e-05
nephrosclerosis -1.106 1.6e-02
non-small cell lung cancer 1.056 1.3e-09
osteosarcoma 2.420 3.2e-04
psoriasis 1.300 2.0e-03

Protein-protein Interaction (3)

Gene RIF (156)

AA Sequence

MTQTLKYASRVFHRVRWAPELGASLGYREYHSARRSLADIPGPSTPSFLAELFCKGGLSRLHELQVQGAA      1 - 70
HFGPVWLASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTEHRRCRQRACGLLTAEGEEWQRLRSL     71 - 140
LAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPPALVRDVAGEFYKFGLEGIAAVLLGSRLGCL    141 - 210
EAQVPPDTETFIRAVGSVFVSTLLTMAMPHWLRHLVPGPWGRLCRDWDQMFAFAQRHVERREAEAAMRNG    211 - 280
GQPEKDLESGAHLTHFLFREELPAQSILGNVTELLLAGVDTVSNTLSWALYELSRHPEVQTALHSEITAA    281 - 350
LSPGSSAYPSATVLSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKNTLVTLCHYATSRDPA    351 - 420
QFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQPEPGAAPVRPK    421 - 490
TRTVLVPERSINLQFLDR                                                        491 - 508
//

Text Mined References (169)

PMID Year Title