Property Summary

NCBI Gene PubMed Count 152
Grant Count 102
R01 Count 61
Funding $10,066,645.56
PubMed Score 464.32
PubTator Score 377.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.106 0.016
malignant mesothelioma 3.800 0.000
psoriasis 1.900 0.000
osteosarcoma 2.420 0.000
glioblastoma 1.100 0.018
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer 1.056 0.000
adult high grade glioma 2.300 0.000
invasive ductal carcinoma 1.100 0.000

Synonym

Accession O15528 B2RC61 Q548T3
Symbols VDR
CP2B
CYP1
PDDR
VDD1
VDDR
VDDRI
CYP27B
P450c1
CYP1alpha

Gene

PANTHER Protein Class (2)

Gene RIF (143)

PMID Text
26607259 this study indicates rs8176345 in CYP27B1 gene is significantly correlated with erlotinib-induced skin rash in patients with advanced non-small cell lung cancer
26575398 Reduced sinonasal levels of 1alpha-hydroxylase are associated with worse quality of life in chronic rhinosinusitis with nasal polyps.
26291067 Increased CYP27B1 expression and local duodenal 1,25(OH)2D3 production during puberty may be a metabolic adaptation that promotes dietary calcium absorption.
26241700 This study reveals no association between CYP27B1 polymorphisms and blood levels of 1alpha,25-hydroxyvitamin D.
26124321 LNCaP cells were stably transfected with CYP27B.
25544771 Data show that cytochrome P450 CYP27B1 and CYP24A1 expression were significantly different between tumor and normal tissues in non-small cell lung cancer (NSCLC).
25542806 Variants of CYP27B1 are associated with both multiple sclerosis and neuromyelitis optica patients in Han Chinese population.
25501638 Results suggest that local expression of CYP27B1 in ovarian tumor cells can modify their behavior and promote a less aggressive phenotype by affecting local concentrations of active of vitamin D levels within the tumor microenvironment.
25488826 Vitamin D-binding protein SNPs are associated with prostate cancer; low 25(OH)D metabolism score and CYP24A1 and CYP27B1 variants are associated with grade
25371233 Case Report: novel pathogenic missense mutation (CYP27B1:Homozygous c.1510C > T(p.Q504X)) causing vitamin D-dependent rickets type 1.
More...

AA Sequence

MTQTLKYASRVFHRVRWAPELGASLGYREYHSARRSLADIPGPSTPSFLAELFCKGGLSRLHELQVQGAA      1 - 70
HFGPVWLASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTEHRRCRQRACGLLTAEGEEWQRLRSL     71 - 140
LAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPPALVRDVAGEFYKFGLEGIAAVLLGSRLGCL    141 - 210
EAQVPPDTETFIRAVGSVFVSTLLTMAMPHWLRHLVPGPWGRLCRDWDQMFAFAQRHVERREAEAAMRNG    211 - 280
GQPEKDLESGAHLTHFLFREELPAQSILGNVTELLLAGVDTVSNTLSWALYELSRHPEVQTALHSEITAA    281 - 350
LSPGSSAYPSATVLSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKNTLVTLCHYATSRDPA    351 - 420
QFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQPEPGAAPVRPK    421 - 490
TRTVLVPERSINLQFLDR                                                        491 - 508
//

Text Mined References (156)

PMID Year Title
26607259 2016 Identification of polymorphic variants associated with erlotinib-related skin toxicity in advanced non-small cell lung cancer patients by DMET microarray analysis.
26575398 2016 Reduced sinonasal levels of 1?-hydroxylase are associated with worse quality of life in chronic rhinosinusitis with nasal polyps.
26291067 2015 Duodenal Expression of 25 Hydroxyvitamin D3-1?-hydroxylase Is Higher in Adolescents Than in Children and Adults.
26241700 2015 CYP24A1 and CYP27B1 Polymorphisms, Concentrations of Vitamin D Metabolites, and Odds of Colorectal Adenoma Recurrence.
26124321 2015 Molecular Mechanism(s) Involved in 25-Hydroxyvitamin D's Antiproliferative Effects in CYP27B1-transfected LNCaP Cells.
25544771 2015 Genetic polymorphisms in the vitamin D pathway in relation to lung cancer risk and survival.
25542806 2015 Variants of CYP27B1 are associated with both multiple sclerosis and neuromyelitis optica patients in Han Chinese population.
25501638 2015 Decreased expression of CYP27B1 correlates with the increased aggressiveness of ovarian carcinomas.
25488826 2015 Associations of vitamin D pathway genes with circulating 25-hydroxyvitamin-D, 1,25-dihydroxyvitamin-D, and prostate cancer: a nested case-control study.
25371233 2014 A novel pathogenic mutation of the CYP27B1 gene in a patient with vitamin D-dependent rickets type 1: a case report.
More...