Property Summary

NCBI Gene PubMed Count 508
Grant Count 348
R01 Count 188
Funding $41,328,904.73
PubMed Score 1747.28
PubTator Score 1010.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytoma 1.500 0.003
psoriasis -1.100 0.000
oligodendroglioma 1.200 0.000
osteosarcoma -2.392 0.000
primitive neuroectodermal tumor 1.200 0.000
tuberculosis 1.200 0.000
lung cancer 1.100 0.007
breast carcinoma 1.500 0.001
group 3 medulloblastoma 1.200 0.008
ovarian cancer -1.100 0.000

Gene

PDB

1EBM   1FN7   1HU0   1KO9   1LWV   1LWW   1LWY   1M3H   1M3Q   1N39   1N3A   1N3C   1YQK   1YQL   1YQM   1YQR   2I5W   2NOB   2NOE   2NOF   2NOH   2NOI   2NOL   2NOZ   2XHI   3IH7   3KTU   5AN4  

Gene RIF (560)

PMID Text
27393451 study points at the elucidation of a possible association of Rheumatoid arthritis (RA) with Ser326Cys in OGG1 Arg194Trp and Arg399Gln polymorphisms of XRCC1 using a sample size of 100 patients and 100 controls from a Pakistani population
26811994 XPC protein is required for OGG1 activity, but XPC does not interacts physically with OGG1.
26692147 Results show that XRCC1-Arg/Gln, XRCC1-Arg/His, and OGG1 A/G polymorphism have a role in the development of rheumatoid arthritis disease.
26600527 our study in the Han Chinese population, along with the meta-analysis, failed to confirm the association of the hOGG1 gene Ser326Cys polymorphism with gastric cancer risk, even across different ethnic populations.
26592168 This preliminary study suggests the possibility of different responses in DNA damage to the physical exercise training, considering the hOGG1 Ser326Cys polymorphism.
26586787 Authors demonstrate proof of concept that mtDNA damage results in breast cancer progression and metastasis in vivo.
26562193 OGG1 Ser/Cys and Ser/Cys + Cys/Cys genotypes had higher multiple sclerosis risk.
26400813 Polymorphisms in OGG1 do not contribute to development of non-small cell lung cancer in Brazilian patients.
26337123 Our results suggest that the circadian modulation of 8-oxoG DNA damage repair, according to a variation of Ogg1 expression, could render humans less susceptible to accumulate 8-oxoG DNA damage in the morning hours.
26261212 In the absence of hSSB1, human 8-oxoguanine glycosylase 1 does not localize to chromatin, resulting in the accumulation of 8-oxoguanine in the genome.
More...

AA Sequence

MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE      1 - 70
EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC     71 - 140
LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA    141 - 210
SARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS    211 - 280
WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG         281 - 345
//

Text Mined References (512)

PMID Year Title
27393451 2016 Polymorphisms in DNA repair genes XRCC1 and OGG1 lead to the progression of rheumatoid arthritis in Pakistani patients.
26811994 XPC deficiency is related to APE1 and OGG1 expression and function.
26692147 2016 Association of XRCC1 and OGG1 DNA repair gene polymorphisms with rheumatoid arthritis in Egyptian patients.
26600527 2015 Lack of association between the hOGG1 gene Ser326Cys polymorphism and gastric cancer risk: evidence from a case-control study and a meta-analysis.
26592168 2015 Effects of physical exercise training in DNA damage and repair activity in humans with different genetic polymorphisms of hOGG1 (Ser326Cys).
26586787 2016 Mitochondrial DNA Repair through OGG1 Activity Attenuates Breast Cancer Progression and Metastasis.
26562193 2015 The impact of detoxifying and repair gene polymorphisms and the levels of serum ROS in the susceptibility to multiple sclerosis.
26400813 2015 DNA Base-Excision Repair Genes OGG1 and NTH1 in Brazilian Lung Cancer Patients.
26337123 2015 Circadian Modulation of 8-Oxoguanine DNA Damage Repair.
26261212 2015 hSSB1 (NABP2/ OBFC2B) is required for the repair of 8-oxo-guanine by the hOGG1-mediated base excision repair pathway.
More...