Property Summary

NCBI Gene PubMed Count 531
PubMed Score 1834.89
PubTator Score 1010.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Renal Cell Carcinoma, Nonpapillary 7

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 1.4e-02
breast carcinoma 1.500 7.3e-04
group 3 medulloblastoma 1.200 8.3e-03
lung cancer 1.100 7.2e-03
malignant mesothelioma 1.100 1.1e-05
oligodendroglioma 1.200 2.7e-18
osteosarcoma -1.242 3.2e-03
ovarian cancer -1.100 7.4e-07
primitive neuroectodermal tumor 1.200 1.1e-04
psoriasis -1.100 8.4e-10
tuberculosis 1.200 4.3e-05

Gene RIF (583)

AA Sequence

MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE      1 - 70
EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC     71 - 140
LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA    141 - 210
SARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS    211 - 280
WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG         281 - 345
//

Text Mined References (535)

PMID Year Title