Property Summary

NCBI Gene PubMed Count 32
PubMed Score 57.97
PubTator Score 34.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cholestasis, Intrahepatic 7 0.0 0.0
Disease Target Count
Intrahepatic cholestasis 20
Disease Target Count Z-score Confidence
Cataract 4 multiple types 14 3.6 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.700 7.5e-06
atypical teratoid / rhabdoid tumor -1.700 5.4e-06
ependymoma -1.100 5.0e-05
glioblastoma -1.200 1.1e-04
lung cancer 1.600 8.1e-05
medulloblastoma, large-cell -1.600 7.7e-05
osteosarcoma -1.687 2.3e-06
tuberculosis -1.200 2.5e-05

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV      1 - 70
KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL     71 - 140
VPGKVAATSVITIVKSKTDARS                                                    141 - 162
//

Text Mined References (39)

PMID Year Title