Property Summary

NCBI Gene PubMed Count 32
Grant Count 31
R01 Count 24
Funding $4,707,249.28
PubMed Score 56.88
PubTator Score 34.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.687 0.000
posterior fossa group B ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.600 0.000
tuberculosis -1.200 0.000
lung cancer 1.600 0.000
adult high grade glioma -1.700 0.000

Gene RIF (8)

PMID Text
25219500 Results show that BRAF(V600E)-mediated upregulation of MAFG is required for transcriptional silencing of MLH1 in colorectal neoplasm.
24140708 PARP-1 serves as a transcriptional coactivator, upregulating the transcriptional activity of Nrf2 by enhancing the interaction among Nrf2, MafG, and the the antioxidant response element.
24118457 MAF genes have different levels of biological and genetic relevance. Besides, MAFF and MAFG could be associated with the susceptibility to develop CML.
22855609 These findings demonstrate that a combination of p45NF-E2, Maf G, and Maf K is a key determinant of both megakaryopoiesis and thrombopoiesis.
21555518 MAFG is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
20689807 Observational study of gene-disease association. (HuGE Navigator)
17928287 the up-regulation of TCF11/MafG binding could be suppressed by overexpression of the TGF-beta inhibitor Smad7, and a small interfering RNA to TCF11 blocked the suppression of iNOS by TGF-beta.
16716189 This study thus manifests that a clear set of rules pertaining to the cis-acting element determine whether a given Maf-recognition elements preferentially associates with MafG homodimer or with MafG:Nrf2 heterodimer.

AA Sequence

MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV      1 - 70
KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL     71 - 140
VPGKVAATSVITIVKSKTDARS                                                    141 - 162
//

Text Mined References (38)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25219500 2014 The BRAF oncoprotein functions through the transcriptional repressor MAFG to mediate the CpG Island Methylator phenotype.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24140708 2014 Poly(ADP-ribose) polymerase-1 modulates Nrf2-dependent transcription.
24118457 2014 Small MAF genes variants and chronic myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...