Property Summary

NCBI Gene PubMed Count 292
Grant Count 264
R01 Count 147
Funding $25,905,843.38
PubMed Score 1072.05
PubTator Score 792.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession O15524 O15097 Q9NSA7 SOCS-1
Symbols JAB
CIS1
SSI1
TIP3
CISH1
SSI-1
SOCS-1

Gene

Gene RIF (271)

PMID Text
27061542 detecting method and sample size also suggested that abnormal SOCS-1 promoter methylation was correlated to the risk of hepatocellular carcinoma in the majority of these subgroups
26990535 miR-203 and miR-221 regulate SOCS1 and SOCS3 in essential thrombocythemia
26812031 Decreased SOCS1 in PBMCs and T cells from patients with ankylosing spondylitis correlates with patient's functional ability, acute-phase reactants and serum pro-inflammatory cytokines.
26747737 Monocytes of juvenile idiopathic arthritis patients expressed higher transcript levels of SOCS1.
26700587 The present study confirmed that both Fas/FasL signaling and SOCS1 promoted the high glucose induced mitochondrial dysfunction and apoptosis; results implies the key regulatory role of Fas signaling and SOCS in diabetic retinopathy
26594049 miR-155 levels were inversely correlated with SOCS1 mRNA expression in oral lichen planus CD4+ T cells.
26573490 The HBVX gene upregulated the mRNA and protein expression levels of DNMT3A/3B, downregulated the expression of SOCS1 and increased SOCS1 gene promoter CpG island methylation.
26391193 SOCS1 pro-oncogenic activity correlated with the down-modulation of STAT1 expression. Collectively, these results suggest that SOCS1 may work as an oncogene in CRC.
26355912 Gal1 and gal3 regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26336985 SOCS1 mutation type qualifies as a single-gene prognostic biomarker in classical Hodgkin lymphoma.
More...

AA Sequence

MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA      1 - 70
SALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGS     71 - 140
RESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQ    141 - 210
I//

Text Mined References (294)

PMID Year Title
27061542 Aberrant promoter methylation of SOCS-1 gene may contribute to the pathogenesis of hepatocellular carcinoma: a meta-analysis.
26990535 2016 miR-203 and miR-221 regulate SOCS1 and SOCS3 in essential thrombocythemia.
26812031 Suppressors of cytokine signalling in ankylosing spondylitis and their associations with disease severity, acute-phase reactants and serum cytokines.
26747737 2016 Altered signaling in systemic juvenile idiopathic arthritis monocytes.
26700587 2016 High glucose induces mitochondrial dysfunction and apoptosis in human retinal pigment epithelium cells via promoting SOCS1 and Fas/FasL signaling.
26594049 2015 MicroRNA-155-IFN-? Feedback Loop in CD4(+)T Cells of Erosive type Oral Lichen Planus.
26573490 2016 Hepatitis B virus X protein upregulates DNA methyltransferase 3A/3B and enhances SOCS-1CpG island methylation.
26391193 2015 Tumour-promoting role of SOCS1 in colorectal cancer cells.
26355912 2015 Galectins regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26336985 2015 Suppressor of cytokine signaling 1 gene mutation status as a prognostic biomarker in classical Hodgkin lymphoma.
More...