Property Summary

NCBI Gene PubMed Count 29
Grant Count 14
R01 Count 4
Funding $931,382.75
PubMed Score 61.10
PubTator Score 40.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26456624 DDX3Y gene rescue of a Y chromosome AZFa deletion restores germ cell formation and transcriptional programs.
26144214 results suggest that MSY genes may play an important role in neural differentiation and demonstrate that DDX3Y could play a multifunctional role in neural cell development
25275262 DLG1, XIST, DDX3Y and RPS4Y1 genes can classify samples into different group clearly, and they are regarded as high confidence distinct gene biomarkers of Parkinson disease.
22466863 fetal germ cell DDX3Y protein expression suggests a role in early spermatogonial proliferation
21709606 We show here the development of a coordinated B and T-cell response to DBY in a recipient of sex mismatched allogeneic hematopoietic stem-cell transplantation.
18299450 Expression of DDX3Y is detected in all myeloid and lymphoid leukemic cells that carry an intact Y chromosome.
17881721 The finding that the testicular transcript of DDX3Y is significantly decreased in patients with severe spermatogenenic failure, especially in those presenting maturation arrest, suggests an important role of DDX3Y during spermatogenesis.
15383328 Human Y- and X-encoded DEAD box RNA helicase proteins DDX3Y and DDX3X are interchangeable and have an essential function. Ddx3x mRNA was expressed in almost every cell in mouse testis, suggesting that Ddx3x is involved in spermatogenesis
15096539 coordinated B and T cell immune response to H-Y minor histocompatibility antigen, DBY, after allogeneic transplant
11929796 graft-versus-host (GVH) disease after HLA-identical stem cell transplantation is the result of recognition of minor histocompatibility antigens (mHags) by immunocompetent T lymphocytes from recipient origin.
More...

AA Sequence

MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYS      1 - 70
SFGSRDSRGKPGYFSERGSGSRGRFDDRGRSDYDGIGNRERPGFGRFERSGHSRWCDKSVEDDWSKPLPP     71 - 140
SERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIP    141 - 210
IIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQI    211 - 280
YEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRM    281 - 350
LDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWV    351 - 420
EDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKS    421 - 490
PILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVE    491 - 560
AKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDYRQSSGSSSSGFGASRGSSSRSGGGGYGNSR    561 - 630
GFGGGGYGGFYNSDGYGGNYNSQGVDWWGN                                            631 - 660
//

Text Mined References (30)

PMID Year Title
26456624 2015 DDX3Y gene rescue of a Y chromosome AZFa deletion restores germ cell formation and transcriptional programs.
26144214 2015 DDX3Y, a Male-Specific Region of Y Chromosome Gene, May Modulate Neuronal Differentiation.
25275262 2014 Identifying distinct candidate genes for early Parkinson's disease by analysis of gene expression in whole blood.
22466863 2012 AZFa protein DDX3Y is differentially expressed in human male germ cells during development and in testicular tumours: new evidence for phenotypic plasticity of germ cells.
21709606 2011 Combined CD4 T-cell and antibody response to human minor histocompatibility antigen DBY after allogeneic stem-cell transplantation.
21269460 2011 Initial characterization of the human central proteome.
20671934 2010 Genetic dissection of the AZF regions of the human Y chromosome: thriller or filler for male (in)fertility?
20561090 2011 Translational control of the AZFa gene DDX3Y by 5'UTR exon-T extension.
19946888 2010 Defining the membrane proteome of NK cells.
18632687 2008 TDRD3, a novel Tudor domain-containing protein, localizes to cytoplasmic stress granules.
More...