Property Summary

NCBI Gene PubMed Count 29
PubMed Score 65.12
PubTator Score 40.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -2.809 2.4e-02
adult high grade glioma -1.700 3.3e-03
Amyotrophic lateral sclerosis 1.169 3.5e-06
Astrocytoma, Pilocytic -2.900 5.7e-03
atypical teratoid / rhabdoid tumor -2.000 3.3e-03
cystic fibrosis -2.100 2.3e-05
gastric cancer -1.100 4.5e-04
glioblastoma -3.100 2.6e-03
intraductal papillary-mucinous neoplasm ... -6.100 6.4e-03
juvenile dermatomyositis -1.273 4.5e-13
malignant mesothelioma 7.200 7.1e-10
medulloblastoma, large-cell -1.600 7.3e-03
non diabetic and post-ischemic heart fai... 1.400 4.6e-02
non primary Sjogren syndrome sicca -2.500 1.5e-02
non-small cell lung cancer -1.520 6.4e-07
oligodendroglioma 1.200 2.8e-02
pancreatic cancer -2.000 7.9e-04
pancreatic carcinoma -2.000 7.9e-04
sarcoidosis 1.600 4.3e-02
spina bifida -5.835 4.5e-04
Systemic lupus erythematosus -1.800 2.7e-02
Waldenstrons macroglobulinemia 2.784 4.3e-02
X-linked cerebral adrenoleukodystrophy 3.900 3.4e-02

Gene RIF (11)

AA Sequence

MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYS      1 - 70
SFGSRDSRGKPGYFSERGSGSRGRFDDRGRSDYDGIGNRERPGFGRFERSGHSRWCDKSVEDDWSKPLPP     71 - 140
SERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIP    141 - 210
IIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQI    211 - 280
YEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRM    281 - 350
LDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWV    351 - 420
EDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKS    421 - 490
PILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVE    491 - 560
AKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDYRQSSGSSSSGFGASRGSSSRSGGGGYGNSR    561 - 630
GFGGGGYGGFYNSDGYGGNYNSQGVDWWGN                                            631 - 660
//

Text Mined References (30)

PMID Year Title