Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.88
PubTator Score 9.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.2e-16
Disease Target Count Z-score Confidence
Tethered spinal cord syndrome 11 4.166 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.400 2.2e-16

Gene RIF (5)

AA Sequence

MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRP      1 - 70
SARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLK     71 - 140
RARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPG    141 - 210
YPAFGPGSALGLFPAYQHLASPALVSWNW                                             211 - 239
//

Text Mined References (17)

PMID Year Title