Property Summary

NCBI Gene PubMed Count 97
PubMed Score 363.01
PubTator Score 183.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Absence of Stensen duct 4
Absence of radius and ulna 15
Absence of the parotid gland 3
Absent proximal phalanx of thumb 3
Absent radius 15
Agenesis of parotid duct 4
Agenesis of punctum lacrimale 4
Alacrima 9
Aplasia of the parotid gland 3
Bilateral fifth finger clinodactyly 110
Bilateral triphalangeal thumbs 3
Broad forehead 59
Broad hallux 29
Capuchin ears 17
Congenital absence of kidney 31
Congenital hypoplasia of radius 23
Corneal Ulcer 21
Coronal hypospadias 4
Cupped ears (finding) 17
Curvature of little finger 110
Dacryocystitis 11
Defective enamel matrix 35
Delayed eruption of primary teeth 10
Dental Enamel Hypoplasia 43
Dental caries 164
Downward slant of palpebral fissure 158
Dysplasia of tooth enamel 35
Epithelial corneal erosions 12
Hearing Loss, Mixed Conductive-Sensorineural 12
Hypodontia 81
Hypoplasia of the lacrimal puncta 3
Hypoplastic lacrimal duct 3
Hypoplastic lacrimal gland 3
Iridocele 3
Lacrimal Duct Obstruction 16
Lacrimal Puncta, Absence of 4
Lacrimal gland aplasia 3
Mammary Neoplasms 425
Obstruction of nasolacrimal duct 9
Orbital separation excessive 244
Parotid gland hypoplasia 3
Partial duplication of thumb phalanx 6
Peg shaped front tooth 6
Peg-shaped incisors 6
Periorbital fullness 9
Pointed front tooth 6
Pointed incisor 6
Radial aplasia 15
Radial deviation of the 3rd finger 4
Radial polydactyly 8
Radial ray hypoplasia 23
Recurrent erosion of cornea 12
Rotting teeth 73
Short ulnae 24
Simple syndactyly of fingers - first web 9
Skin hyperelastic 32
Subcoronal hypospadias 4
Telecanthus 62
Thenar hypoplasia 4
Thin dental enamel 35
ULNAR HYPOPLASIA 24
Xerostomia 42
nephrosclerosis 333
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7
Prostate cancer 175 0.0 3.0
Disease Target Count
LADD syndrome 9

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma -1.272 2.8e-03
lung adenocarcinoma -1.100 1.3e-07
lung carcinoma -1.400 1.2e-09
posterior fossa group B ependymoma 1.400 9.0e-04

Protein-protein Interaction (5)

Gene RIF (64)

AA Sequence

MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSY      1 - 70
NHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKL     71 - 140
YGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS      141 - 208
//

Text Mined References (98)

PMID Year Title