Property Summary

NCBI Gene PubMed Count 94
Grant Count 289
R01 Count 176
Funding $30,466,710.46
PubMed Score 345.09
PubTator Score 183.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.300 0.000
posterior fossa group B ependymoma 1.400 0.001
invasive ductal carcinoma -1.800 0.001
lung carcinoma -1.400 0.000

Synonym

Accession O15520 C7FDY0 Q6FHR3 Q6FHT6 Q96P59 FGF-10
Symbols

Gene

PANTHER Protein Class (2)

PDB

1NUN  

 GWAS Trait (1)

Gene RIF (61)

PMID Text
26511927 Fgf10 signaling has an essential role in the formation of lipofibroblasts during late lung development
26268776 Expression of Fibroblast Growth Factor 10 is correlated with poor prognosis in gastric adenocarcinoma.
25446127 FGF10 has a role in protecting neuron against oxygen-glucose deprivation injury through inducing heme oxygenase-1
24865969 The therapeutic potential of the FGF10 treatment.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of fibroblast growth factor 10 (FGF10) in primary human brain microvascular endothelial cells
24582960 Data identify autocrine activation of FGF signaling as an essential mechanism in promoting Pten-deficient skin tumors.
24320134 FGF10 plays an important role for tumor growth by both paracrine and autocrine manner.
24265547 Three FGF10 single nucleotide polymorphisms in complete linkage disequilibrium--rs339501, rs12517396, and rs10462070--were associated with extreme myopia in the Japanese population.
24004862 The findings show that immunohistochemistry with FGF10, FGFR2b, or SHH could be useful in differentiating CCAM from type I PPB, when a child presents with a focal cystic lung lesion.
24002438 High FGF10 expression is associated with ameloblastoma.
More...

AA Sequence

MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSY      1 - 70
NHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKL     71 - 140
YGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS      141 - 208
//

Text Mined References (95)

PMID Year Title
26511927 2015 Evidence for the involvement of fibroblast growth factor 10 in lipofibroblast formation during embryonic lung development.
26268776 2015 Expression of Fibroblast Growth Factor 10 Is Correlated with Poor Prognosis in Gastric Adenocarcinoma.
25446127 2015 Fibroblast growth factor 10 protects neuron against oxygen-glucose deprivation injury through inducing heme oxygenase-1.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24865969 2014 Human marrow stromal cells downsize the stem cell fraction of lung cancers by fibroblast growth factor 10.
24582960 2014 Pten loss induces autocrine FGF signaling to promote skin tumorigenesis.
24320134 2014 Role of FGF10 on tumorigenesis by MS-K.
24265547 2013 Association study of fibroblast growth factor 10 (FGF10) polymorphisms with susceptibility to extreme myopia in a Japanese population.
24004862 2013 FGF10 Signaling differences between type I pleuropulmonary blastoma and congenital cystic adenomatoid malformation.
24002438 2013 Fibroblast growth factors 7 and 10 are involved in ameloblastoma proliferation via the mitogen-activated protein kinase pathway.
More...