Property Summary

NCBI Gene PubMed Count 290
Grant Count 408
R01 Count 258
Funding $35,379,479.05
PubMed Score 837.30
PubTator Score 1983.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
cutaneous lupus erythematosus 1.400 0.000
psoriasis -3.800 0.000
osteosarcoma -4.133 0.000
glioblastoma 1.300 0.000
acute quadriplegic myopathy 1.540 0.001
Amyotrophic Lateral Sclerosis 1.133 0.000
adrenocortical carcinoma -1.204 0.000
pancreatic ductal adenocarcinoma liver m... 1.429 0.004
non-small cell lung cancer -2.299 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.003
colon cancer -1.400 0.018
lung cancer -4.600 0.000
interstitial cystitis 1.200 0.001
lung adenocarcinoma -1.600 0.000
group 3 medulloblastoma 1.300 0.020
aldosterone-producing adenoma -1.264 0.006
lung carcinoma -2.100 0.000
spina bifida -1.675 0.044
Pick disease 1.200 0.000
Breast cancer -1.400 0.000
Bipolar Disorder 1.115 0.046
ulcerative colitis 1.400 0.000
ovarian cancer -2.000 0.000
Gaucher disease type 1 -1.100 0.016
pituitary cancer -1.200 0.007
dermatomyositis -1.400 0.003

Synonym

Accession O15519 B4DJE0 B7Z9F9 O14673 O14674 O14675 O15137 O15138 O15356 O15510 O43618 O43619 O43620 O60458 O60459 Q53TS6 Q54AF1 Q96TE4 Q9UEW1
Symbols CASH
FLIP
MRIT
CLARP
FLAME
Casper
FLAME1
c-FLIP
FLAME-1
I-FLICE
c-FLIPL
c-FLIPR
c-FLIPS
CASP8AP1

Gene

PDB

3H11   2N5R   3H13  

 GWAS Trait (1)

Gene RIF (257)

PMID Text
26990987 procaspase-8:c-FLIPL exhibits localized enzymatic activity and is preferentially an activator, promoting DED-mediated procaspase-8 oligomer assembly, whereas procaspase-8:c-FLIPS lacks activity and potently blocks procaspase-8 activation
26865630 This conservation of IKK activation among the cFLIP family using different mechanisms suggests that the mechanism plays a critical role in their function.
26716649 High FLIP expression is associated with Pancreatic cancer.
26667821 A dual role for cFLIP in the maintenance of breast cancer stem cell viability, dependent upon its subcellular distribution.
26648023 Our findings suggested that GA induces apoptosis via the downregulation of cFLIPL and sensitized TRAIL-mediated apoptosis in Caki cells.
26529318 Identification and Characterization of the Interaction Site between cFLIPL and Calmodulin.
26261530 c-FLIP and RIP can inhibit caspase-8 activation and prompting HepG2 and Hep3B resistant to cell apoptosis induced by TRAIL.
26258756 Reduced miR-512 and the elevated expression of its targets cFLIP and MCL1 localize to neurons with hyperphosphorylated Tau protein in Alzheimer disease.
26195820 cFLIP-mediated and caspase-8-dependent limited cleavage of RIP1 is a new layer of mechanism that promotes NF-KB activation and lymphoma survival.
26142735 The result indicated that TMZ may overcome TRAIL resistance in GSCs by suppressing c-FLIP expression through c-Cbl-mediated ubiquitination and degradation
More...

AA Sequence

MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKR      1 - 70
ILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEK     71 - 140
LNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKE    141 - 210
QRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQK    211 - 280
FLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAG    281 - 350
KPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP    351 - 420
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT              421 - 480
//

Text Mined References (293)

PMID Year Title
26990987 2016 Co-operative and Hierarchical Binding of c-FLIP and Caspase-8: A Unified Model Defines How c-FLIP Isoforms Differentially Control Cell Fate.
26865630 2016 Distinct Activation Mechanisms of NF-?B Regulator Inhibitor of NF-?B Kinase (IKK) by Isoforms of the Cell Death Regulator Cellular FLICE-like Inhibitory Protein (cFLIP).
26716649 2016 Simultaneous gene silencing of KRAS and anti-apoptotic genes as a multitarget therapy.
26667821 2015 Cytoplasmic levels of cFLIP determine a broad susceptibility of breast cancer stem/progenitor-like cells to TRAIL.
26648023 2016 Gambogic acid induces apoptosis and sensitizes TRAIL-mediated apoptosis through downregulation of cFLIPL in renal carcinoma Caki cells.
26529318 2015 Identification and Characterization of the Interaction Site between cFLIPL and Calmodulin.
26261530 2015 Protective effect of RIP and c-FLIP in preventing liver cancer cell apoptosis induced by TRAIL.
26258756 2015 Reduced miR-512 and the Elevated Expression of Its Targets cFLIP and MCL1 Localize to Neurons With Hyperphosphorylated Tau Protein in Alzheimer Disease.
26195820 2015 RIP1 Cleavage in the Kinase Domain Regulates TRAIL-Induced NF-?B Activation and Lymphoma Survival.
26142735 2015 Temozolomide sensitizes stem-like cells of glioma spheres to TRAIL-induced apoptosis via upregulation of casitas B-lineage lymphoma (c-Cbl) protein.
More...