Property Summary

NCBI Gene PubMed Count 203
PubMed Score 392.74
PubTator Score 427.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.365 4.4e-05
adult high grade glioma -1.100 7.9e-04
Amyotrophic lateral sclerosis 1.093 2.5e-05
atypical teratoid / rhabdoid tumor -1.300 1.6e-05
diabetes mellitus -1.700 2.7e-03
glioblastoma -1.500 9.9e-07
hereditary spastic paraplegia -1.187 2.9e-02
juvenile dermatomyositis 1.264 8.2e-09
lung cancer -1.200 4.7e-03
medulloblastoma, large-cell -1.900 5.1e-04
osteosarcoma 4.431 5.4e-14
ovarian cancer -1.600 2.1e-07
pancreatic ductal adenocarcinoma liver m... -1.214 4.3e-02
psoriasis 1.500 1.7e-03
Rheumatoid arthritis 1.100 3.7e-02

Protein-protein Interaction (2)

Gene RIF (209)

AA Sequence

MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDK      1 - 70
STVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTS     71 - 140
LLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTY    141 - 210
EYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRH    211 - 280
SLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIW    281 - 350
LQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA    351 - 420
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSV    421 - 490
GSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHG    491 - 560
QGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQS    561 - 630
TSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQ    631 - 700
IRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSV    701 - 770
QQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP    771 - 840
SKVQPQ                                                                    841 - 846
//

Text Mined References (208)

PMID Year Title