Property Summary

NCBI Gene PubMed Count 188
Grant Count 290
R01 Count 189
Funding $35,172,969.97
PubMed Score 348.84
PubTator Score 427.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession O15516 A0AV01 A2I2N9 O14516 Q9UIT8 hCLOCK
Symbols KAT13D
bHLHe8

Gene

PDB

4H10  

 GWAS Trait (1)

Gene RIF (194)

PMID Text
26850841 when overexpressed, c-MYC is able to repress Per1 transactivation by BMAL1/CLOCK via targeting selective E-box sequences. Importantly, upon serum stimulation, MYC was detected in BMAL1 protein complexes
26739996 CLOCK gene variation is associated with incidence of type-2 diabetes and cardiovascular diseases in type-2 diabetic subjects. Suggest diet-gene interaction.
26553137 Clock gene variants associated with obesity and sleep duration. [review]
26453284 The CLOCK 3111T > C polymorphism could be an independent risk factor for irregular menstrual cycles, irrespective of psychological distress and endocrine or metabolic conditions in Korean adolescents.
26390085 Findings indicate that CLOCK protein plays an important role in fertility and its knockdown leads to reduction in reproduction and increased miscarriage risk.
26299356 Upregulation of CLOCK is associated with the expression of HIF-1alpha and VEGF in varicose veins.
26247999 possible circadian rhythm in full-term placental expression
26204460 CLOCK rs1801260 modulated the relationship between early stress, adult history of attempted suicide and current suicide ideation
26181468 Variants of the CLOCK gene are associated with idiopathic male infertility and therefore may be applied as a risk factor of male infertility.
26164627 these findings suggest that sumoylation plays a critical role in the spatiotemporal co-activation of CLOCK-BMAL1 by CBP for immediate-early Per induction and the resetting of the circadian clock.
More...

AA Sequence

MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDK      1 - 70
STVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTS     71 - 140
LLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTY    141 - 210
EYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRH    211 - 280
SLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIW    281 - 350
LQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA    351 - 420
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSV    421 - 490
GSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHG    491 - 560
QGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQS    561 - 630
TSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQ    631 - 700
IRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSV    701 - 770
QQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP    771 - 840
SKVQPQ                                                                    841 - 846
//

Text Mined References (193)

PMID Year Title
26850841 2016 c-MYC targets the central oscillator gene Per1 and is regulated by the circadian clock at the post-transcriptional level.
26739996 2016 CLOCK gene variation is associated with incidence of type-2 diabetes and cardiovascular diseases in type-2 diabetic subjects: dietary modulation in the PREDIMED randomized trial.
26553137 2015 Association between genetic variants of the clock gene and obesity and sleep duration.
26453284 2015 Association between the CLOCK gene 3111 T?>?C polymorphism and an irregular menstrual cycle in Korean adolescents.
26390085 2015 Circadian clock gene plays a key role on ovarian cycle and spontaneous abortion.
26299356 2015 Upregulation of the gene expression of CLOCK is correlated with hypoxia-inducible factor 1? in advanced varicose lesions.
26247999 2015 Evidence for clock genes circadian rhythms in human full-term placenta.
26204460 2015 Effects of CLOCK gene variants and early stress on hopelessness and suicide in bipolar depression.
26181468 2015 Variants of the CLOCK gene affect the risk of idiopathic male infertility in the Han-Chinese population.
26164627 2015 Sumoylation controls CLOCK-BMAL1-mediated clock resetting via CBP recruitment in nuclear transcriptional foci.
More...