Property Summary

NCBI Gene PubMed Count 73
PubMed Score 3.34
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
hepatocellular carcinoma 547 1.0e-05
ovarian cancer 8520 2.9e-05
osteosarcoma 7950 1.2e-04
pancreatic cancer 2398 1.3e-02
pancreatic carcinoma 562 1.3e-02
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 5 11 3.77 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.300 1.0e-05
osteosarcoma -1.849 1.2e-04
ovarian cancer 1.500 2.9e-05
pancreatic cancer 1.100 1.3e-02
pancreatic carcinoma 1.100 1.3e-02

Synonym

Accession O15514 Q52LT4 RNA polymerase II subunit B4
Symbols RBP4
RPB16
HSRBP4
HSRPB4

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   2C35  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (78)

AA Sequence

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTAR      1 - 70
FSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSF     71 - 140
QY                                                                        141 - 142
//

Text Mined References (74)

PMID Year Title