Property Summary

NCBI Gene PubMed Count 17
Grant Count 15
R01 Count 8
Funding $1,715,178.11
PubMed Score 10.14
PubTator Score 10.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma 1.200 0.046
osteosarcoma -1.007 0.022
Pick disease -1.400 0.000

Gene RIF (20)

PMID Text
26401039 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
22250199 NLP1 functions as an accessory factor in CRM1-dependent nuclear protein export
21318276 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
21318276 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20012529 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
20012529 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
19458171 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
19275582 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
More...

AA Sequence

MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQPSSFSKSTPWG      1 - 70
GSRDQEKPYFSSFDSGASTNRKEGFGLSENPFASLSPDEQKDEKKLLEGIVKDMEVWESSGQWMFSVYSP     71 - 140
VKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQRLINQWRNRVNELKSLNISTKVALLSDVKDG    141 - 210
VNQAAPAFGFGSSQAATFMSPGFPVNNSSSDNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSG    211 - 280
ISTSAPAFGFGKPEVTSAASFSFKSPAASSFGSPGFSGLPASLATGPVRAPVAPAFGGGSSVAGFGSPGS    281 - 350
HSHTAFSKPSSDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL    351 - 420
LNV                                                                       421 - 423
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22250199 2012 The nucleoporin-like protein NLP1 (hCG1) promotes CRM1-dependent nuclear protein export.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16000379 2005 Interaction between the shuttling mRNA export factor Gle1 and the nucleoporin hCG1: a conserved mechanism in the export of Hsp70 mRNA.
15820316 2005 Molecular cloning and functional characterization of mouse Nxf family gene products.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...