Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.51
PubTator Score 10.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Pick disease 1894 3.9e-06
osteosarcoma 7950 2.2e-02
astrocytic glioma 2597 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 2.3

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma 1.200 4.6e-02
osteosarcoma -1.007 2.2e-02
Pick disease -1.400 3.9e-06

Gene RIF (15)

AA Sequence

MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQPSSFSKSTPWG      1 - 70
GSRDQEKPYFSSFDSGASTNRKEGFGLSENPFASLSPDEQKDEKKLLEGIVKDMEVWESSGQWMFSVYSP     71 - 140
VKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQRLINQWRNRVNELKSLNISTKVALLSDVKDG    141 - 210
VNQAAPAFGFGSSQAATFMSPGFPVNNSSSDNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSG    211 - 280
ISTSAPAFGFGKPEVTSAASFSFKSPAASSFGSPGFSGLPASLATGPVRAPVAPAFGGGSSVAGFGSPGS    281 - 350
HSHTAFSKPSSDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL    351 - 420
LNV                                                                       421 - 423
//

Text Mined References (21)

PMID Year Title