Property Summary

NCBI Gene PubMed Count 49
Grant Count 31
R01 Count 27
Funding $2,838,818.76
PubMed Score 177.28
PubTator Score 79.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis -1.900 0.000
osteosarcoma 1.544 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
glioblastoma 1.600 0.001
medulloblastoma, large-cell 1.600 0.000
Atopic dermatitis -1.700 0.009
tuberculosis -2.400 0.000
pancreatic ductal adenocarcinoma liver m... -3.036 0.000
Hydrolethalus syndrome -1.778 0.029
lung cancer -2.100 0.000
active Crohn's disease 2.769 0.001
active ulcerative colitis 2.099 0.001
non primary Sjogren syndrome sicca 1.100 0.021
Breast cancer 1.300 0.000
lung carcinoma -1.200 0.000
spina bifida -2.269 0.039
Pick disease -1.300 0.000
gastric carcinoma -1.500 0.034
ovarian cancer -1.100 0.001
chronic rhinosinusitis -1.383 0.024

Gene RIF (36)

PMID Text
25028659 identified interaction of three genes in INSIG-SCAP-SREBP pathway on risk of obesity, revealing that these genes affect obesity more likely through a complex interaction pattern than single gene effect.
24484994 Our results indicated that the dysregulation of INSIG1 and SREBF1 caused by ART were observed not only in the fetus but also in the placenta, primarily in the ICSI group
24371122 Data show the essential role of PPARgamma and PPARgamma coactivator 1alpha (PGC-1alpha) in up-regulating Insig-1/2 expression, defining a mechanistic pathway triggered by CD36, and leading to cholesterol depletion in hepatocytes.
23333304 HIV-1 Vif upregulates the expression of insulin induced gene 1 (INSIG1) in Vif-expression T cells
20877301 No significant associations were found between polymorphisms of INSIG1 gene and metabolic syndrome; however, INSIG1 and INSIG2 interactions were found in the significant 3-locus and 4-locus gene-gene interaction models.
20877301 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20444954 Common variation in INSIG1 is unlikely to have a major effect on risk of type 2 diabetes risk in white Europeans.
20444954 Observational study of gene-disease association. (HuGE Navigator)
19965593 From genetic association studies, SNPs in INSIG1 (including the promoter region) influence hypertriglyceridemia.
More...

AA Sequence

MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGP      1 - 70
EPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVV     71 - 140
GLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSG    141 - 210
LGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD       211 - 277
//

Text Mined References (50)

PMID Year Title
27198006 2016 Statin-induced expression change of INSIG1 in lymphoblastoid cell lines correlates with plasma triglyceride statin response in a sex-specific manner.
25028659 2014 The gene-gene interaction of INSIG-SCAP-SREBP pathway on the risk of obesity in Chinese children.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24484994 2014 Assisted reproductive technologies impair the expression and methylation of insulin-induced gene 1 and sterol regulatory element-binding factor 1 in the fetus and placenta.
24371122 2014 Scavenger receptor CD36 mediates inhibition of cholesterol synthesis via activation of the PPAR?/PGC-1? pathway and Insig1/2 expression in hepatocytes.
23919961 2013 Adaptive changes of the Insig1/SREBP1/SCD1 set point help adipose tissue to cope with increased storage demands of obesity.
22648509 2012 PKNOX2 is associated with formal thought disorder in schizophrenia: a meta-analysis of two genome-wide association studies.
21343306 2011 Membrane-associated ubiquitin ligase complex containing gp78 mediates sterol-accelerated degradation of 3-hydroxy-3-methylglutaryl-coenzyme A reductase.
21081644 2011 Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase.
20877301 2012 Gene-gene interactions of the INSIG1 and INSIG2 in metabolic syndrome in schizophrenic patients treated with atypical antipsychotics.
More...