Property Summary

NCBI Gene PubMed Count 53
PubMed Score 186.91
PubTator Score 79.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.863 2.0e-03
active ulcerative colitis 1.683 4.8e-03
Atopic dermatitis -1.700 9.2e-03
atypical teratoid / rhabdoid tumor 1.100 9.0e-04
Breast cancer 1.300 6.7e-07
chronic rhinosinusitis -1.383 2.4e-02
gastric carcinoma -1.500 3.4e-02
glioblastoma 1.600 7.8e-04
Hydrolethalus syndrome -1.675 4.8e-02
lung cancer -1.200 3.2e-03
lung carcinoma -1.200 7.0e-14
malignant mesothelioma 1.600 2.4e-07
medulloblastoma, large-cell 1.600 6.2e-05
non primary Sjogren syndrome sicca 1.100 2.1e-02
osteosarcoma 1.544 1.6e-04
ovarian cancer -1.100 1.0e-03
pancreatic ductal adenocarcinoma liver m... -2.725 1.1e-03
Pick disease -1.300 3.3e-04
psoriasis -1.700 7.0e-04
spina bifida -2.015 3.7e-02
tuberculosis -2.200 3.5e-05

Gene RIF (39)

AA Sequence

MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGP      1 - 70
EPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVV     71 - 140
GLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSG    141 - 210
LGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD       211 - 277
//

Text Mined References (54)

PMID Year Title