Property Summary

NCBI Gene PubMed Count 20
PubMed Score 38.98
PubTator Score 28.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.300 1.7e-05
lung cancer 1.400 3.6e-02
Multiple myeloma 1.393 7.4e-05
non primary Sjogren syndrome sicca 1.100 3.2e-02
non-small cell lung cancer 1.536 7.9e-19
psoriasis 1.300 4.9e-09

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVKEQDYLCHVYV      1 - 70
RNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMT     71 - 140
KVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM                141 - 198
//

Text Mined References (25)

PMID Year Title