Property Summary

NCBI Gene PubMed Count 20
PubMed Score 36.79
PubTator Score 28.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 7.9321650704485E-19
psoriasis 6685 7.05692175192356E-8
glioblastoma 5572 1.69274192107995E-5
Multiple myeloma 1328 7.41703366030897E-5
non primary Sjogren syndrome sicca 840 0.0315893552606342
lung cancer 4473 0.035850296610909
Disease Target Count Z-score Confidence
Vici syndrome 16 4.665 2.3

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.393 0.000
psoriasis 1.400 0.000
glioblastoma 1.300 0.000
non-small cell lung cancer 1.536 0.000
lung cancer 1.400 0.036
non primary Sjogren syndrome sicca 1.100 0.032

Synonym

Accession O15498 B4DR94 Q53F01 Q6FGU9 Q6IB15
Symbols

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
16821082 mRNA expression of CCT5, RGS3, and YKT6 was significantly up-regulated in p53-mutated tumors and associated with a low response rate to docetaxel.
14607937 N-ethylmaleimide-sensitive factor-dependent SNARE-priming complex disassembly is required for efficient exocytosis from mast cells.
12388752 Data suggest that GS15 exists in a distinct SNARE complex that contains syntaxin5, GS28, and Ykt6, and may be involved in both ER-to-Golgi and intra-Golgi transport.
11884350 abnormalities in the SNARE complex could represent a molecular substrate for abnormalities of neural connectivity in severe mental disorders

AA Sequence

MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVKEQDYLCHVYV      1 - 70
RNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMT     71 - 140
KVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM                141 - 198
//

Text Mined References (25)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16821082 2007 Possible involvement of CCT5, RGS3, and YKT6 genes up-regulated in p53-mutated tumors in resistance to docetaxel in human breast cancers.
16354670 2006 Involvement of a novel Q-SNARE, D12, in quality control of the endomembrane system.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15544955 2004 Longins and their longin domains: regulated SNAREs and multifunctional SNARE regulators.
More...