Property Summary

NCBI Gene PubMed Count 42
Grant Count 20
R01 Count 13
Funding $1,560,802.64
PubMed Score 288.44
PubTator Score 182.60

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

Gene RIF (37)

PMID Text
26828067 PLA2G10 releases omega-3 polyunsaturated fatty acids, suppresses colitis, and promotes sperm fertility.
26139511 Endogenous secreted phospholipase A2 group X regulates cysteinyl leukotrienes synthesis by human eosinophils
25964585 sPLA2GIII expression may be used as a risk factor for lymph node metastasis and a prognostic marker in colorectal cancer. In addition, sPLA2GIII and sPLA2GX may play opposing roles in colorectal carcinogenesis
25583995 PLA2G10 variants are not significantly associated with plasma sPLA2 activity or with CHD risk.
25286228 Studies indicate that the expression of secreted phospholipases A2 (sPLA2s), most notably the group IIA, III and X enzymes, is dysregulated in various malignant tissues.
24508801 Data indicate that the expression of genes encoding hGIIA, hGIII and hGX sPLA2s (PLA2G2A, PLA2G3 and PLA2G10, respectively) in breast tumour biopsies differs from that in normal tissues.
24070020 hGX sPLA2 is a novel modulator of lipid metabolism that promotes breast cancer cell growth and survival by stimulating lipid droplet formation and fatty acid oxidation.
23859159 The enzyme activity of sPLA2 is not altered in serum and cerebrospinal fluid of patients with relapsing-remitting multiple sclerosis during the course of the disease.
23614662 Secreted phospholipase A2 group X plays a key role in regulating eicosanoid formation and the development of inflammation and airway hyperresponsiveness in murine models.
23349189 PLA2G10 expression in bone marrow cells controls a proatherogenic Th1 response and limits the development of atherosclerosis.
More...

AA Sequence

MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCG      1 - 70
LGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCL     71 - 140
AQTEYNLKYLFYPQFLCEPDSPKCD                                                 141 - 165
//

Text Mined References (43)

PMID Year Title
26828067 2016 Group X Secreted Phospholipase A2 Releases ?3 Polyunsaturated Fatty Acids, Suppresses Colitis, and Promotes Sperm Fertility.
26139511 2016 Endogenous secreted phospholipase A2 group X regulates cysteinyl leukotrienes synthesis by human eosinophils.
25964585 2015 Phospholipase A2 Group III and Group X Have Opposing Associations with Prognosis in Colorectal Cancer.
25583995 2015 PLA2G10 Gene Variants, sPLA2 Activity, and Coronary Heart Disease Risk.
25286228 2014 Secreted phospholipases A2 in cancer: diverse mechanisms of action.
24508801 2014 Secreted phospholipases A?are differentially expressed and epigenetically silenced in human breast cancer cells.
24070020 2013 Group X secreted phospholipase A(2) induces lipid droplet formation and prolongs breast cancer cell survival.
23859159 2013 Secretory phospholipase A2 activity in serum and cerebrospinal fluid of patients with relapsing-remitting multiple sclerosis.
23614662 2013 Regulation and function of epithelial secreted phospholipase A2 group X in asthma.
23349189 2013 Group X secreted phospholipase A2 limits the development of atherosclerosis in LDL receptor-null mice.
More...