Property Summary

Ligand Count 32
NCBI Gene PubMed Count 44
PubMed Score 298.19
PubTator Score 182.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (37)

AA Sequence

MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCG      1 - 70
LGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCL     71 - 140
AQTEYNLKYLFYPQFLCEPDSPKCD                                                 141 - 165
//

Text Mined References (45)

PMID Year Title