Property Summary

NCBI Gene PubMed Count 39
Grant Count 65
R01 Count 48
Funding $5,641,126.59
PubMed Score 42.20
PubTator Score 37.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
interstitial lung disease -1.200 0.024
posterior fossa group B ependymoma -1.200 0.003
oligodendroglioma -1.200 0.006
glioblastoma 1.700 0.019
medulloblastoma, large-cell 1.400 0.041
tuberculosis and treatment for 3 months -2.900 0.000
non-small cell lung cancer -1.141 0.000
lung cancer -1.500 0.000
pancreatic cancer 1.700 0.000
Breast cancer 2.200 0.037
group 4 medulloblastoma -1.800 0.008
invasive ductal carcinoma 1.100 0.016
ovarian cancer 2.000 0.009
pituitary cancer -2.800 0.000

Synonym

Accession O15492 B2R4M4 Q5VYN9 Q99701 RGS16
Symbols RGS-R
A28-RGS14
A28-RGS14P

Gene

PANTHER Protein Class (2)

PDB

2IK8   2BT2  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1888 confirmatory 53 / 0 / 132 Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao.
2298 confirmatory 25 / 0 / 11 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS16-Galphao for SAR Compounds

Gene RIF (20)

PMID Text
26823172 suggest that deltaEF1 family proteins promote cell motility of breast cancer cells directly or indirectly through repressing expression of RGS16
26013170 The data establish miR-181a as an oncomiR that promotes chondrosarcoma progression through a new mechanism involving enhancement of CXCR4 signaling by inhibition of RGS16.
25366993 these results indicate that RGS16 restricts the activation-induced pro-inflammatory profile in myeloid cells.
23354309 cotreatment with RGS16 siRNA reversed the downregulation of nuclear factor-kappaB expression induced by combined inhibition of LSD1 and HDACs, suggesting a crucial role of RGS16 in controlling key pathways of cell death in response to combination therapy.
23248035 Data indicate that multiplex ligation-dependent probe amplification (MLPA) probes (Fig. 2) corresponding to the RGSL2, RGSL1 and RGS16 genes showed 64.5 % tumour samples with copy number gains and 5 % tumour samples with copy number losses.
21135262 Missense mutations in RGS16 gene is associated with breast cancer.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20571966 RGS16 and FosB are underexpressed in pancreatic cancer with lymph node metastasis and associated with reduced survival
19760045 Increased RGS16 levels are associated with colorectal cancer.
19509421 the loss of RGS16 in some breast tumors enhances PI3K signaling elicited by growth factors and thereby promotes proliferation and TKI evasion downstream of HER activation
More...

AA Sequence

MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLL      1 - 70
SSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELT     71 - 140
RMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT            141 - 202
//

Text Mined References (41)

PMID Year Title
26823172 2016 The potential role of regulator of G-protein signaling 16 in cell motility mediated by ?EF1 family proteins.
26013170 2015 miR-181a Targets RGS16 to Promote Chondrosarcoma Growth, Angiogenesis, and Metastasis.
25366993 2015 RGS16 restricts the pro-inflammatory response of monocytes.
23354309 2013 Crosstalk between lysine-specific demethylase 1 (LSD1) and histone deacetylases mediates antineoplastic efficacy of HDAC inhibitors in human breast cancer cells.
23248035 2013 Chromosome 1q25.3 copy number alterations in primary breast cancers detected by multiplex ligation-dependent probe amplification and allelic imbalance assays and its comparison with fluorescent in situ hybridization assays.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21135262 2011 High-resolution melting analysis for mutation screening of RGSL1, RGS16, and RGS8 in breast cancer.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20571966 2010 RGS16 and FosB underexpressed in pancreatic cancer with lymph node metastasis promote tumor progression.
19760045 2009 RGS16 is a marker for prognosis in colorectal cancer.
More...