Property Summary

NCBI Gene PubMed Count 39
PubMed Score 43.32
PubTator Score 37.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer 2.200 3.7e-02
ependymoma -1.100 1.6e-02
glioblastoma 1.700 1.9e-02
group 4 medulloblastoma -1.800 7.6e-03
interstitial lung disease -1.200 2.4e-02
invasive ductal carcinoma 1.100 1.6e-02
lung cancer 1.400 8.6e-03
medulloblastoma, large-cell 1.400 4.1e-02
non-small cell lung cancer -1.141 2.4e-06
oligodendroglioma -1.200 6.5e-03
ovarian cancer 2.000 9.2e-03
pancreatic cancer 1.700 4.9e-05
pituitary cancer -2.800 1.5e-06
tuberculosis -2.600 1.7e-06

Gene RIF (20)

AA Sequence

MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLL      1 - 70
SSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELT     71 - 140
RMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT            141 - 202
//

Text Mined References (41)

PMID Year Title