Property Summary

NCBI Gene PubMed Count 14
PubMed Score 91.96
PubTator Score 30.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -1.500 4.3e-02
atypical teratoid / rhabdoid tumor 1.300 4.5e-05
breast carcinoma -2.300 1.9e-03
colon cancer 1.200 2.5e-02
ductal carcinoma in situ -3.100 1.8e-04
ependymoma 1.300 4.7e-02
fibroadenoma -3.100 2.3e-02
intraductal papillary-mucinous adenoma (... 2.000 3.5e-04
intraductal papillary-mucinous neoplasm ... 2.000 2.8e-03
invasive ductal carcinoma -3.100 1.4e-03
oligodendroglioma 1.100 3.3e-02
osteosarcoma 2.539 1.4e-04
ovarian cancer 1.700 2.2e-02
pancreatic ductal adenocarcinoma liver m... -1.123 3.6e-03
psoriasis -1.600 1.1e-02

Protein-protein Interaction (10)

Gene RIF (3)

AA Sequence

MSETEFHHGAQAGLELLRSSNSPTSASQSAGMTVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVV      1 - 70
LITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLV     71 - 140
LSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTT    141 - 210
DIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFL    211 - 280
HLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSN    281 - 350
QPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVES    351 - 420
VSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFA    421 - 490
RIQEKLDRFLQ                                                               491 - 501
//

Text Mined References (17)

PMID Year Title