Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.15
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 0.00593715892029831
Disease Target Count Z-score Confidence
Malaria 140 5.184 2.6
Color blindness 2 3.863 1.9
Endometritis 21 3.121 1.6

Gene RIF (2)

PMID Text
19098318 TEX28 gene CNVs (copy number variations) appear to be associated with the MYP1 X-linked myopia phenotypes.
15378397 proposed a structure of the second gene of 3-gene arrays, Green-pTEX-Green-pTEX-Green-fTEX and Red-pTEX-Red-pTEX-Red-fTEX, in color-vision-deficient subjects

AA Sequence

MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGPSSLADGGLAHNLQDSVRHRILYLSEQLRVEKASRD      1 - 70
GNTVSYLKLVSKADRHQVPHIQQAFEKVNQRASATIAQIEHRLHQCHQQLQELEEGCRPEGLLLMAESDP     71 - 140
ANCEPPSEKALLSEPPEPGGEDGPVNLPHASRPFILESRFQSLQQGTCLETEDVAQQQNLLLQKVKAELE    141 - 210
EAKRFHISLQESYHSLKERSLTDLQLLLESLQEEKCRQALMEEQVNGRLQGQLNEIYNLKHNLACSEERM    211 - 280
AYLSYERAKEIWEITETFKSRISKLEMLQQVTQLEAAEHLQSRPPQMLFKFLSPRLSLATVLLVFVSTLC    281 - 350
ACPSSLISSRLCTCTMLMLIGLGVLAWQRWRAIPATDWQEWVPSRCRLYSKDSGPPADGP              351 - 410
//

Text Mined References (8)

PMID Year Title
19098318 2009 Evaluation of the X-linked high-grade myopia locus (MYP1) with cone dysfunction and color vision deficiencies.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378397 2004 An insertion/deletion TEX28 polymorphism and its application to analysis of red/green visual pigment gene arrays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9268643 1997 Identification of a gene within the tandem array of red and green color pigment genes.