Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.15
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (2)

PMID Text
19098318 TEX28 gene CNVs (copy number variations) appear to be associated with the MYP1 X-linked myopia phenotypes.
15378397 proposed a structure of the second gene of 3-gene arrays, Green-pTEX-Green-pTEX-Green-fTEX and Red-pTEX-Red-pTEX-Red-fTEX, in color-vision-deficient subjects

AA Sequence

MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGPSSLADGGLAHNLQDSVRHRILYLSEQLRVEKASRD      1 - 70
GNTVSYLKLVSKADRHQVPHIQQAFEKVNQRASATIAQIEHRLHQCHQQLQELEEGCRPEGLLLMAESDP     71 - 140
ANCEPPSEKALLSEPPEPGGEDGPVNLPHASRPFILESRFQSLQQGTCLETEDVAQQQNLLLQKVKAELE    141 - 210
EAKRFHISLQESYHSLKERSLTDLQLLLESLQEEKCRQALMEEQVNGRLQGQLNEIYNLKHNLACSEERM    211 - 280
AYLSYERAKEIWEITETFKSRISKLEMLQQVTQLEAAEHLQSRPPQMLFKFLSPRLSLATVLLVFVSTLC    281 - 350
ACPSSLISSRLCTCTMLMLIGLGVLAWQRWRAIPATDWQEWVPSRCRLYSKDSGPPADGP              351 - 410
//

Text Mined References (8)

PMID Year Title
19098318 2009 Evaluation of the X-linked high-grade myopia locus (MYP1) with cone dysfunction and color vision deficiencies.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378397 2004 An insertion/deletion TEX28 polymorphism and its application to analysis of red/green visual pigment gene arrays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9268643 1997 Identification of a gene within the tandem array of red and green color pigment genes.