Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.43
PubTator Score 13.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Expression

Synonym

Accession O15479 O75860
Symbols DAM6
CT3.2
MAGE-XP-2

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
26468294 MageB2 counteracts E2F inhibition by ribosomal proteins independently of Mdm2 expression
23029077 we identified MAGEB2 as activated by promoter demethylation in HNSCCand demonstrates growth promoting effects in a minimally transformed oral keratinocyte cell line.
17012225 Valproic acid causes a change in acetylation of this gene.
12018852 Results show that hypertonic culture medium differentially induces the expression of melanoma antigens B1 and B2 (MAGE-B1, -B2) in different human tumor cell lines.

AA Sequence

MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAA      1 - 70
AAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKI     71 - 140
VGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGV    141 - 210
IFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAY    211 - 280
AETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV                                   281 - 319
//

Text Mined References (18)

PMID Year Title
26468294 2015 Human MageB2 Protein Expression Enhances E2F Transcriptional Activity, Cell Proliferation, and Resistance to Ribotoxic Stress.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029077 2012 MAGEB2 is activated by promoter demethylation in head and neck squamous cell carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17012225 2007 Valproate induces widespread epigenetic reprogramming which involves demethylation of specific genes.
More...