Property Summary

NCBI Gene PubMed Count 32
Grant Count 60
R01 Count 27
Funding $9,388,881.37
PubMed Score 252.25
PubTator Score 141.25

Knowledge Summary

Patent

No data available

Synonym

Accession O15467 Q4KKU0
Symbols LEC
LMC
NCC4
CKb12
HCC-4
LCC-1
Mtn-1
NCC-4
SCYL4
ILINCK
SCYA16

Gene

Gene RIF (13)

PMID Text
22857868 High umbilical artery CCL16 is prominently detected in preterm preeclamptic pregnancies with severe growth restriction.
21951809 Data show that CCL-16 gene expression was upregulated by 7.46-fold in IBS patients when compared with controls and suggest a subclinical inflammatory component underlying IBS.
21288736 Low umbilical cord blood chemokine CCL16 associates with spontaneous preterm birth
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19494526 Elevated concentrations in bronchoalveolar lavage fluid from patients with eosinophilic pneumonia
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17122780 Observational study of gene-disease association. (HuGE Navigator)
16226254 CC chemokine-4 (HCC-4)/CCL16 transduces signals differently from other CCR1-dependent chemokines and may play different roles in the immune response.
More...

AA Sequence

MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTK      1 - 70
RNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ                         71 - 120
//

Text Mined References (32)

PMID Year Title
23954997 2013 Expression pattern of serum cytokines in hepatitis B virus infected patients with persistently normal alanine aminotransferase levels.
23922012 2014 Therapeutic immunization and local low-dose tumor irradiation, a reinforcing combination.
23602049 2013 The role of inflammatory chemokines in lymphoid neoorganogenesis in breast cancer.
22857868 2012 Umbilical artery chemokine CCL16 is associated with preterm preeclampsia and fetal growth restriction.
22147696 2012 Biochemical analysis of matrix metalloproteinase activation of chemokines CCL15 and CCL23 and increased glycosaminoglycan binding of CCL16.
21951809 2011 Pro-inflammatory chemokine C-C motif ligand 16 (CCL-16) dysregulation in irritable bowel syndrome (IBS): a pilot study.
21288736 2011 Cord blood chemokines differentiate between spontaneous and elective preterm births in singleton pregnancies.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19494526 2009 Elevated concentrations of liver-expressed chemokine/CC chemokine ligand 16 in bronchoalveolar lavage fluid from patients with eosinophilic pneumonia.
More...