Property Summary

NCBI Gene PubMed Count 33
PubMed Score 263.57
PubTator Score 141.25

Knowledge Summary

Patent

No data available

Synonym

Accession O15467 Q4KKU0
Symbols LEC
LMC
NCC4
CKb12
HCC-4
LCC-1
Mtn-1
NCC-4
SCYL4
ILINCK
SCYA16

Gene

  Ortholog (1)

Species Source Disease
Dog OMA Inparanoid

Gene RIF (14)

AA Sequence

MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTK      1 - 70
RNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ                         71 - 120
//

Text Mined References (33)

PMID Year Title