Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.47
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.70928587918688E-10
atypical teratoid / rhabdoid tumor 4369 7.51946052345878E-9
osteosarcoma 7933 8.58010655215265E-7
pituitary cancer 1972 1.71030780904687E-6
medulloblastoma, large-cell 6234 7.27756273817857E-6
glioblastoma 5572 1.8511653256164E-4
group 3 medulloblastoma 2254 7.38269362230083E-4
adult high grade glioma 2148 0.00523318052675903
primitive neuroectodermal tumor 3031 0.0208011245217

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma -2.500 0.000
osteosarcoma 1.019 0.000
glioblastoma -1.800 0.000
group 3 medulloblastoma -2.800 0.001
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.700 0.021
adult high grade glioma -1.700 0.005
pituitary cancer 1.600 0.000

Synonym

Accession O15466 B7Z1K9 Q6IAW7
Symbols SIAT8E
SIAT8-E
ST8SiaV

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20930939 Chol-1alpha antigens (cholinergic neuron-specific gangliosides), such as GT1aalpha and GQ1balpha, which are minor species in the brain, are increased in the double-transgenic mouse brain.

AA Sequence

MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRCLELRHEILEV      1 - 70
KVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTTQKNTPLGTKLKYEVDTSGIY     71 - 140
HINQEIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGREINSADFVFRCNLPPISEKYTMDVGVKTDV    141 - 210
VTVNPSIITERFHKLEKWRRPFYRVLQVYENASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQ    211 - 280
YLVNVSRYWLSLGVRAKRISTGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAM    281 - 350
PSEIFNFLHLHSRGILRVHTGTCSCC                                                351 - 376
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20930939 2010 Ganglioside metabolism in a transgenic mouse model of Alzheimer's disease: expression of Chol-1? antigens in the brain.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9199191 1997 Molecular cloning and expression of human alpha2,8-sialyltransferase (hST8Sia V).
9129712 1997 Isolation of chromosome 18-specific brain transcripts as positional candidates for bipolar disorder.