Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.47
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma -2.500 0.000
osteosarcoma 1.019 0.000
glioblastoma -1.800 0.000
group 3 medulloblastoma -2.800 0.001
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.700 0.021
adult high grade glioma -1.700 0.005
pituitary cancer 1.600 0.000

Synonym

Accession O15466 B7Z1K9 Q6IAW7
Symbols SIAT8E
SIAT8-E
ST8SiaV

Gene

Gene RIF (1)

PMID Text
20930939 Chol-1alpha antigens (cholinergic neuron-specific gangliosides), such as GT1aalpha and GQ1balpha, which are minor species in the brain, are increased in the double-transgenic mouse brain.

AA Sequence

MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRCLELRHEILEV      1 - 70
KVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTTQKNTPLGTKLKYEVDTSGIY     71 - 140
HINQEIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGREINSADFVFRCNLPPISEKYTMDVGVKTDV    141 - 210
VTVNPSIITERFHKLEKWRRPFYRVLQVYENASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQ    211 - 280
YLVNVSRYWLSLGVRAKRISTGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAM    281 - 350
PSEIFNFLHLHSRGILRVHTGTCSCC                                                351 - 376
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20930939 2010 Ganglioside metabolism in a transgenic mouse model of Alzheimer's disease: expression of Chol-1? antigens in the brain.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9199191 1997 Molecular cloning and expression of human alpha2,8-sialyltransferase (hST8Sia V).
9129712 1997 Isolation of chromosome 18-specific brain transcripts as positional candidates for bipolar disorder.