Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.53
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 7.1e-03
atypical teratoid / rhabdoid tumor -1.600 1.2e-04
ependymoma -1.200 3.1e-02
glioblastoma -1.100 7.3e-03
group 3 medulloblastoma -1.700 5.7e-04
medulloblastoma, large-cell -1.900 1.7e-06
osteosarcoma 1.019 8.6e-07
pituitary cancer 1.600 1.7e-06
primitive neuroectodermal tumor -1.100 3.6e-02

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRCLELRHEILEV      1 - 70
KVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTTQKNTPLGTKLKYEVDTSGIY     71 - 140
HINQEIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGREINSADFVFRCNLPPISEKYTMDVGVKTDV    141 - 210
VTVNPSIITERFHKLEKWRRPFYRVLQVYENASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQ    211 - 280
YLVNVSRYWLSLGVRAKRISTGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAM    281 - 350
PSEIFNFLHLHSRGILRVHTGTCSCC                                                351 - 376
//

Text Mined References (8)

PMID Year Title