Property Summary

NCBI Gene PubMed Count 38
Grant Count 64
R01 Count 34
Funding $8,370,550.2
PubMed Score 57.43
PubTator Score 68.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 0.002
medulloblastoma, large-cell 2.000 0.000
adult high grade glioma 1.100 0.005
ovarian cancer 1.400 0.000

Synonym

Accession O15444 A1L4J4 A6NI52 A8K9E7 B5MCA5 Q96KJ7
Symbols TECK
Ckb15
SCYA25

Gene

Gene RIF (20)

PMID Text
26879872 Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis.
26472015 CpG methylation is reduced in gingival biopsies of patients with periodontitis
26279399 CCL25 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group.
25691296 CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway.
25296976 Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls.
25275597 TECK derived from endometrial stromal cell and macrophages upregulates the number and function of Tregs in the ectopic milieu.
24936795 High CCL25 expression is associated with the pathogenesis of ulcerative colitis.
22863617 CCL25 and CCR9 regulate colorectal cancer progression and invasion.
22102554 cell migration assays revealed that mesenchymal stromal cells (MSCs) have tropism toward multiple myeloma (MM) cells, and CCL25 was identified as a major MM cell-produced chemoattractant for MSCs.
21637913 We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes.
More...

AA Sequence

MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKR      1 - 70
HRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNV     71 - 140
SLLISANSGL                                                                141 - 150
//

Text Mined References (41)

PMID Year Title
26879872 2016 CCR9 in cancer: oncogenic role and therapeutic targeting.
26472015 2016 Epigenetic characteristics in inflammatory candidate genes in aggressive periodontitis.
26279399 2015 Intracellular expression profile and clinical significance of the CCR9-CCL25 chemokine receptor complex in nasopharyngeal carcinoma.
25691296 2015 CCR9-CCL25 interaction suppresses apoptosis of lung cancer cells by activating the PI3K/Akt pathway.
25296976 2014 CCR9/CCL25 expression in non-small cell lung cancer correlates with aggressive disease and mediates key steps of metastasis.
25275597 2014 CD4+Foxp3+ regulatory T cell differentiation mediated by endometrial stromal cell-derived TECK promotes the growth and invasion of endometriotic lesions.
24936795 2014 CCL25/CCR9 interactions regulate the function of iNKT cells in oxazolone-induced colitis in mice.
23341447 2013 ?-Arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.
22863617 2012 Chemokine 25-induced signaling suppresses colon cancer invasion and metastasis.
22102554 2012 Bone marrow-derived mesenchymal stromal cells are attracted by multiple myeloma cell-produced chemokine CCL25 and favor myeloma cell growth in vitro and in vivo.
More...