Property Summary

NCBI Gene PubMed Count 42
PubMed Score 59.13
PubTator Score 68.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.100 5.5e-03
atypical teratoid / rhabdoid tumor 1.400 1.9e-03
medulloblastoma, large-cell 2.000 1.5e-04
ovarian cancer 1.400 4.1e-07

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (24)

AA Sequence

MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKR      1 - 70
HRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNV     71 - 140
SLLISANSGL                                                                141 - 150
//

Text Mined References (45)

PMID Year Title