Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.74
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 3.26762672933543E-12
atypical teratoid / rhabdoid tumor 4369 5.16691384969148E-10
glioblastoma 5572 1.38322042036453E-6
pilocytic astrocytoma 3086 4.03346550334622E-5
medulloblastoma 1524 1.01225804268196E-4
pediatric high grade glioma 2712 1.11869631987503E-4
primitive neuroectodermal tumor 3031 0.00192214631805171
astrocytic glioma 2241 0.0033877413406095
medulloblastoma, large-cell 6234 0.00409774189459778
oligodendroglioma 2849 0.00823071973876325
Disease Target Count Z-score Confidence
WAGR syndrome 12 4.267 2.1
Aniridia 26 4.159 2.1
Nephroblastoma 45 3.107 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.900 0.003
ependymoma -2.700 0.000
oligodendroglioma -1.800 0.008
glioblastoma -3.900 0.000
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.100 0.004
primitive neuroectodermal tumor -3.100 0.002
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -2.700 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQP      1 - 70
PHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPY     71 - 140
EYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSP    141 - 210
WQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLH    211 - 280
VFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS                            281 - 326
//

Text Mined References (9)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9266672 1997 The 239AB gene on chromosome 22: a novel member of an ancient gene family.
8666403 1995 cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region.