Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.74
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.400 3.5e-03
astrocytic glioma -1.100 4.0e-03
Astrocytoma, Pilocytic -1.400 1.3e-04
atypical teratoid / rhabdoid tumor -1.600 3.1e-08
ependymoma -1.200 5.4e-03
glioblastoma -1.200 2.6e-05
medulloblastoma -1.500 1.8e-02
medulloblastoma, large-cell -1.200 1.1e-02
oligodendroglioma -1.100 1.2e-02
primitive neuroectodermal tumor -1.400 2.5e-03

Gene RIF (1)

AA Sequence

MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQP      1 - 70
PHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPY     71 - 140
EYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSP    141 - 210
WQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLH    211 - 280
VFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS                            281 - 326
//

Text Mined References (9)

PMID Year Title