Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.74
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.900 0.003
ependymoma -2.700 0.000
oligodendroglioma -1.800 0.008
glioblastoma -3.900 0.000
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.100 0.004
primitive neuroectodermal tumor -3.100 0.002
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -2.700 0.000

Synonym

Accession O15442 A8K159 B7Z2S9 Q8N361
Symbols 239AB
FAM1A
C22orf1

Gene

PANTHER Protein Class (1)

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQP      1 - 70
PHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPY     71 - 140
EYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSP    141 - 210
WQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLH    211 - 280
VFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS                            281 - 326
//

Text Mined References (9)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9266672 1997 The 239AB gene on chromosome 22: a novel member of an ancient gene family.
8666403 1995 cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region.