Property Summary

NCBI Gene PubMed Count 53
Grant Count 41
R01 Count 14
Funding $3,419,167.74
PubMed Score 116.97
PubTator Score 103.19

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (37)

PMID Text
26515061 ABCC5 is a general glutamate conjugate and analog transporter that affects the disposition of endogenous metabolites, toxins, and drugs.
26353179 genetic association study in population in Mexico: Data suggest SNPs in ABCC5 (3933+313T>C) are not associated with adverse reactions to methotrexate; they protect against myelosuppression in pediatric patients with ALL (acute lymphoblastic leukemia).
25964343 To identify substrates of orphan transporter ATP-binding cassette subfamily C member 5 (ABCC5), identified a class of metabolites, N-lactoyl-amino acids, and found that a protease, cytosolic nonspecific dipeptidase 2 (CNDP2), catalyzes their formation.
25829401 We identified several genes (FasL, MSH2, ABCC5, CASP3, and CYP3A4)that showed association with PFS in patients with osteosarcoma. These pharmacogenetic risk factors might be useful to predict treatment outcome
25564970 The present study investigated the time course and dose dependency of the induction of three efflux proteins, P-gp, MRP1 and MRP5, in response to gemcitabine exposure in Capan-2 pancreatic cancer cell line at transcriptional and translational levels.
25117150 ABCC5 transporter is a novel type 2 diabetes susceptibility gene in European and African American populations.
25028266 The blockade of ABC transporter MRP5 could help to improve drug effectiveness, reduce tumour growth and prevent recurrence in glioblastoma multiforme.
25017019 cCMP is a substrate for MRP5
24603532 This locus was associated with an increase in risk of PACG in a separate case-control study of 4,276 primary angle closure glaucoma cases and 18,801 controls (per-allele OR = 1.13 [95% CI: 1.06-1.22], P = 0.00046).
23271324 Further research is needed to clarify whether MRP5 is indicative of malignant pathological features in meningiomas and whether possible therapeutic implications exist
More...

AA Sequence

MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLR      1 - 70
ILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHE     71 - 140
SSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQA    141 - 210
TESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINIC    211 - 280
SNDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAA    281 - 350
TDERVQKMNEVLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV    351 - 420
HMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKI    421 - 490
EMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPE    491 - 560
EEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQ    561 - 630
QAWILNATLRDNILFGKEYDEERYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALY    631 - 700
SDRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEEL    701 - 770
MNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGS    771 - 840
VPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETSVSDSMKDNPH    841 - 910
MQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMD    911 - 980
EVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRVLIRELKRLDNITQSPF    981 - 1050
LSHITSSIQGLATIHAYNKGQEFLHRYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLM   1051 - 1120
HGQIPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQE   1121 - 1190
GEVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISD   1191 - 1260
IGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNF   1261 - 1330
SVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVL   1331 - 1400
AQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG                                    1401 - 1437
//

Text Mined References (58)

PMID Year Title
26515061 2015 ATP-binding Cassette Subfamily C Member 5 (ABCC5) Functions as an Efflux Transporter of Glutamate Conjugates and Analogs.
26353179 2015 Association of ABCB1, ABCC5 and xanthine oxidase genetic polymorphisms with methotrexate adverse reactions in Mexican pediatric patients with ALL.
25964343 2015 N-lactoyl-amino acids are ubiquitous metabolites that originate from CNDP2-mediated reverse proteolysis of lactate and amino acids.
25829401 2015 A First Step toward Personalized Medicine in Osteosarcoma: Pharmacogenetics as Predictive Marker of Outcome after Chemotherapy-Based Treatment.
25564970 2015 Time and concentration dependency of P-gp, MRP1 and MRP5 induction in response to gemcitabine uptake in Capan-2 pancreatic cancer cells.
25117150 2014 ABCC5 transporter is a novel type 2 diabetes susceptibility gene in European and African American populations.
25028266 2014 ABC transporters as differentiation markers in glioblastoma cells.
25017019 2014 cCMP is a substrate for MRP5.
24603532 2014 ABCC5, a gene that influences the anterior chamber depth, is associated with primary angle closure glaucoma.
23271324 2013 Immunohistochemical study of MRP5 expression in meningiomas.
More...