Property Summary

NCBI Gene PubMed Count 160
PubMed Score 341.61
PubTator Score 238.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.686 3.3e-02
adult high grade glioma 1.400 3.6e-04
Astrocytoma, Pilocytic 1.600 1.3e-09
atypical teratoid / rhabdoid tumor 1.800 1.8e-03
cystic fibrosis 1.200 2.6e-02
ependymoma 1.600 4.2e-10
gastric cancer 1.100 6.1e-04
glioblastoma 1.200 1.7e-07
group 4 medulloblastoma -1.500 1.9e-05
interstitial cystitis -1.600 2.6e-03
lung cancer -1.600 5.8e-05
lung carcinoma -1.900 4.1e-27
malignant mesothelioma -1.100 1.2e-05
medulloblastoma, large-cell 1.200 2.0e-02
osteosarcoma 1.246 8.1e-03
ovarian cancer 1.700 2.6e-04
primary Sjogren syndrome 1.300 3.7e-03
primitive neuroectodermal tumor 1.100 2.4e-02
tuberculosis 1.600 2.6e-06

Gene RIF (137)

AA Sequence

MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLR      1 - 70
AENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYFENYDPMDSVALNTAYAYATV     71 - 140
LTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTV    141 - 210
FLHFLWAGPLQAIAVTALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVI    211 - 280
TGIRIIKMYAWEKSFSNLITNLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASR    281 - 350
VFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD    351 - 420
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLR    421 - 490
SNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDD    491 - 560
PLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSL    561 - 630
LKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQA    631 - 700
YKNYFRAGAHWIVFIFLILLNTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSG    701 - 770
LTVATVLFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF    771 - 840
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPVFSHLSSSLQG    841 - 910
LWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFVIIVAFGSLILAKTLDAGQVG    911 - 980
LALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLEKEAPWEYQKRPPPAWPHEGVIIFDNVNFMY    981 - 1050
SPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSII   1051 - 1120
PQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARA   1121 - 1190
ILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV   1191 - 1260
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL        1261 - 1325
//

Text Mined References (169)

PMID Year Title