Property Summary

NCBI Gene PubMed Count 151
Grant Count 131
R01 Count 64
Funding $10,509,810.04
PubMed Score 316.00
PubTator Score 238.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer 1.100 0.001
malignant mesothelioma -1.100 0.000
osteosarcoma 1.246 0.008
posterior fossa group B ependymoma 2.200 0.000
glioblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.800 0.002
medulloblastoma, large-cell 1.600 0.001
primitive neuroectodermal tumor 1.100 0.024
tuberculosis 1.600 0.000
lung cancer -1.600 0.000
active ulcerative colitis -1.686 0.033
interstitial cystitis -1.600 0.003
cystic fibrosis 1.400 0.005
pediatric high grade glioma 1.500 0.000
sonic hedgehog group medulloblastoma 1.600 0.002
pilocytic astrocytoma 2.100 0.000
primary Sjogren syndrome 1.300 0.004
lung carcinoma -1.900 0.000
ovarian cancer 1.700 0.000

Synonym

Accession O15439 A9Z1Z7 B7Z3Q7 Q8IVZ4 Q8IZN6 Q8NEW8 Q9Y6J2
Symbols MRP4
MOATB
MOAT-B

Gene

Gene RIF (128)

PMID Text
26842729 ABCC4 plays a protective role against cytarabine-mediated insults in leukemic and host myeloid cells.
26807589 Approximately 20% of HIV-infected patients receiving tenofovir showed beta2-microglobulinuria. The C allele at position 4976 of the ABCC4 gene was associated with beta2-microglobulinuria in this population.
26611713 Sulfate metabolites R-6-S and R-4'-S were generated from raloxifene in SULT293 expression HEK293 cells. Cellular excretion of the raloxifene sulfates was mainly mediated by BCRP and MRP4.
26600514 the specific COX-2 inhibitor meloxicam can increase the intracellular accumulation of doxorubicin and enhance doxorubicin-induced cytotoxicity in A549 cancer cells by reducing the expression of MRP1 and MRP4.
26499190 ABCC4 levels were significantly upregulated both in human NK/T-cell lymphoma YTS and SNK-6 cells. ABCC4 overexpression induced chemotherapy resistance to epirubicin and cisplatin in YTS cells, and inhibited apoptosis.
26497925 Results demonstrated the capacity of MRP4 to confer resistance to arsenite (AsIII), as evidenced by cell survival assays when treated with AsIII in the presence or absence of its two differential inhibitors.
26491233 MRP4 overexpression is important to reduce aspirin-selective cell death
26405223 These findings have important clinical implications because they directly highlight an important relationship between ABCC4 transporter function and phosphodiesterases in accounting for the cAMP-directed activity of antithrombotic agents.
26291395 This study aimed to establish SULT1A3 stably transfected HEK293 cells, and to determine the contributions of BCRP and MRP transporters to excretion of chrysin and apigenin sulfates.
26141932 Osteoarthritis patient platelets presented a higher expression of MRP4.
More...

AA Sequence

MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLR      1 - 70
AENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYFENYDPMDSVALNTAYAYATV     71 - 140
LTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTV    141 - 210
FLHFLWAGPLQAIAVTALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVI    211 - 280
TGIRIIKMYAWEKSFSNLITNLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASR    281 - 350
VFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD    351 - 420
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLR    421 - 490
SNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDD    491 - 560
PLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSL    561 - 630
LKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQA    631 - 700
YKNYFRAGAHWIVFIFLILLNTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSG    701 - 770
LTVATVLFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF    771 - 840
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPVFSHLSSSLQG    841 - 910
LWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFVIIVAFGSLILAKTLDAGQVG    911 - 980
LALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLEKEAPWEYQKRPPPAWPHEGVIIFDNVNFMY    981 - 1050
SPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSII   1051 - 1120
PQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARA   1121 - 1190
ILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV   1191 - 1260
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL        1261 - 1325
//

Text Mined References (160)

PMID Year Title
26842729 2016 ABCC4 Is a Determinant of Cytarabine-Induced Cytotoxicity and Myelosuppression.
26807589 2016 A Single-Nucleotide Polymorphism in ABCC4 Is Associated with Tenofovir-Related Beta2-Microglobulinuria in Thai Patients with HIV-1 Infection.
26611713 2015 Sulfonation of raloxifene in HEK293 cells overexpressing SULT1A3: Involvement of breast cancer resistance protein (BCRP/ABCG2) and multidrug resistance-associated protein 4 (MRP4/ABCC4) in excretion of sulfate metabolites.
26600514 2015 Meloxicam increases intracellular accumulation of doxorubicin via downregulation of multidrug resistance-associated protein 1 (MRP1) in A549 cells.
26499190 2015 ATP-binding cassette sub-family C member 4 (ABCC4) is overexpressed in human NK/T-cell lymphoma and regulates chemotherapy sensitivity: Potential as a functional therapeutic target.
26497925 2016 Multidrug resistance-associated protein 4 is a determinant of arsenite resistance.
26491233 2015 Multidrug Resistance Protein-4 Influences Aspirin Toxicity in Human Cell Line.
26405223 2015 The ABCC4 membrane transporter modulates platelet aggregation.
26291395 2015 Efflux transport of chrysin and apigenin sulfates in HEK293 cells overexpressing SULT1A3: The role of multidrug resistance-associated protein 4 (MRP4/ABCC4).
26141932 2016 Nonsteroidal anti-inflammatory drugs in-vitro and in-vivo treatment and Multidrug Resistance Protein 4 expression in human platelets.
More...