Property Summary

NCBI Gene PubMed Count 83
Grant Count 114
R01 Count 54
Funding $9,685,280.89
PubMed Score 279.83
PubTator Score 446.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O15438 B2RPA9 D3DTX9 O60265 O60922 O75621 O95078 O95289 O95290 Q86X85 Q9UN52
Symbols MLP2
MRP3
ABC31
MOAT-D
cMOAT2
EST90757

Gene

Gene RIF (74)

PMID Text
26107220 ABCC3 rs4148416 polymorphism was significantly associated with poor osteosarcoma response.
25985567 ABCC3 promoter methylation does not seem to exhibit any impact on maximum platelet aggregation and clopidogrel response at all
25788542 Data suggest that hepatic expression of MRP3 is up-regulated and canalicular localization of MRP2 is altered in pediatric patients with advanced nonalcoholic steatohepatitis; these alterations may be involved in changes observed in drug metabolism.
25666946 Epidermal growth factor - mediated epithelial-mesenchymal transition induces ABCC3 mRNA in MDA-MB-468 breast cancer cells. The process is calcium dependant.
25349122 A functional Nrf2 response element within the eighth intron of the ABCC3 gene.
25162314 for ABCC3 variants, little evidence, if any, was found for an association of drug response to genetic variants
25155932 Our data suggest that besides bodyweight, OCT1 and ABCC3 genotypes play a significant role in the pharmacokinetics of intravenous morphine and its metabolites in children
25143454 Renal function of MRP3 is related to renal cell proliferation and cyst formation and that restoring MRP3 may be an effective therapeutic approach for polycystic kidney disease.
25088576 Aberrant expression of MRP3 in rectal cancer confers chemo-radioresistance.
24996541 variants of ABCB1 rs128503, ABCC3 rs4148416, and GSTP1 rs1695 are associated with response to chemotherapy and survival of osteosarcoma patients
More...

AA Sequence

MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHCRGYIILSHLS      1 - 70
KLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIF     71 - 140
WFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFALVLSALILACFREKPPFFSAKNVDPNPYPET    141 - 210
SAGFLSRLFFWWFTKMAIYGYRHPLEEKDLWSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNA    211 - 280
SGEDEVLLGARPRPRKPSFLKALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGF    281 - 350
LVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF    351 - 420
MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKL    421 - 490
MSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPN    491 - 560
NVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLKRIQQFLSQEELDPQSVERKTISPGYAITIH    561 - 630
SGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWI    631 - 700
QNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDAD    701 - 770
IFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ    771 - 840
RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSAL    841 - 910
SSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVG    911 - 980
QSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLH    981 - 1050
NKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAV   1051 - 1120
LYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYII   1121 - 1190
SNRWLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV   1191 - 1260
KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKS   1261 - 1330
SMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALE   1331 - 1400
LSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRT   1401 - 1470
QFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIAARGIFYGMARDAGLA                1471 - 1527
//

Text Mined References (88)

PMID Year Title
26107220 2015 Quantitative Assessment of the Association between ABC Polymorphisms and Osteosarcoma Response: a Meta-analysis.
25985567 2014 The association of ABCC3 promoter methylation with clopidogrel response in Chinese ischemic stroke patients.
25788542 2015 Altered regulation of hepatic efflux transporters disrupts acetaminophen disposition in pediatric nonalcoholic steatohepatitis.
25666946 2015 A role for calcium in the regulation of ATP-binding cassette, sub-family C, member 3 (ABCC3) gene expression in a model of epidermal growth factor-mediated breast cancer epithelial-mesenchymal transition.
25349122 2015 Identification of a functional antioxidant response element within the eighth intron of the human ABCC3 gene.
25162314 2014 Polymorphisms of the drug transporters ABCB1, ABCG2, ABCC2 and ABCC3 and their impact on drug bioavailability and clinical relevance.
25155932 2014 ABCC3 and OCT1 genotypes influence pharmacokinetics of morphine in children.
25143454 2015 Restoring multidrug resistance-associated protein 3 attenuates cell proliferation in the polycystic kidney.
25088576 2014 Multidrug resistance-associated protein 3 confers resistance to chemoradiotherapy for rectal cancer by regulating reactive oxygen species and caspase-3-dependent apoptotic pathway.
24996541 2014 Predictive potential of ABCB1, ABCC3, and GSTP1 gene polymorphisms on osteosarcoma survival after chemotherapy.
More...