Property Summary

NCBI Gene PubMed Count 12
Grant Count 35
R01 Count 19
Funding $9,268,670.5
PubMed Score 53.92
PubTator Score 25.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26411550 Decreased expression of CTR2 is associated with clear cell renal cell carcinoma.
26205368 Studied the interaction of CTR1 and CTR2 in fully malignant HEK293T and OVCAR8 human ovarian cancer cells using a CRISPR-Cas9 knock out system.
24703712 Data suggest that SLC31A1 and SLC31A2, despite being structurally closely related and sharing important amino acid motifs, play different roles in copper homeostasis and in platinum-based chemotherapy of neoplasms. [REVIEW]
24522273 Over-expression of CTR2 increased exchangeable Cu(+) by 150% and rendered the human epithelial 2008 cancer cell model 2.5-fold resistant to cisplatin.
23564780 Increased CTR2 expression is associated with platinum resistance in epithelial ovarian cancer.
19509135 CTR2 functions by limiting drug accumulation, and its expression correlates with the sensitivity of human ovarian carcinoma cell lines to cisplatin.
17944601 Ctr2 promotes copper uptake at the plasma membrane and plays a role in regulating copper levels in COS-7 cells
17617060 hCTR2 is as an oligomeric membrane protein localized in lysosomes, which stimulates copper delivery to the cytosol of human cells at relatively high copper concentrations.

AA Sequence

MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAET      1 - 70
DGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLL     71 - 140
STA                                                                       141 - 143
//

Text Mined References (13)

PMID Year Title
26411550 2016 Decreased expression of CTR2 predicts poor prognosis of patients with clear cell renal cell carcinoma.
26205368 2015 The copper transporter 1 (CTR1) is required to maintain the stability of copper transporter 2 (CTR2).
24703712 2015 The role of Ctr1 and Ctr2 in mammalian copper homeostasis and platinum-based chemotherapy.
24522273 2014 Copper transporter 2 regulates intracellular copper and sensitivity to cisplatin.
23564780 2013 Association of copper transporter expression with platinum resistance in epithelial ovarian cancer.
19509135 2009 Copper transporter 2 regulates the cellular accumulation and cytotoxicity of Cisplatin and Carboplatin.
17944601 2008 Ctr2 is partially localized to the plasma membrane and stimulates copper uptake in COS-7 cells.
17617060 2007 Human copper transporter 2 is localized in late endosomes and lysosomes and facilitates cellular copper uptake.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...