Property Summary

NCBI Gene PubMed Count 62
Grant Count 7
R01 Count 4
Funding $751,649.17
PubMed Score 84.19
PubTator Score 185.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 0.004
glioblastoma 1.200 0.005
pancreatic ductal adenocarcinoma liver m... -1.752 0.001
pancreatic carcinoma 1.100 0.004
subependymal giant cell astrocytoma 1.111 0.034
ovarian cancer 2.400 0.000

 GWAS Trait (1)

Gene RIF (54)

PMID Text
26851002 High CTR1 Expression is associated with poor response to chemotherapy in Muscle-invasive Bladder Cancer.
26745413 C-Terminus of Human Copper Importer Ctr1 Acts as a Binding Site and Transfers Copper to Atox1
26205368 Studied the interaction of CTR1 and CTR2 in fully malignant HEK293T and OVCAR8 human ovarian cancer cells using a CRISPR-Cas9 knock out system.
26067577 Gene silencing of either CTR1 or DMT1 did not affect copper accumulation in cells, but deficiency in both CTR1 and DMT1 resulted in a complete inhibition of copper uptake.
26061257 Two methionine residues in the MXXXM motif of of the CTR1 second transmembrane domain are important for binding to silver.
25823781 allele distribution of the SLC31A1 was not different between group N and O, and out of the 11 SNPs of the SLC22A2 gene only the allele distribution of the nonsynonymous SNP was significantly different between patients who experienced ototoxicity
24837030 The data collected here shows that the Atox1 keeps its dimer nature also in the presence of the CTR1 c-terminal domain; however, two geometrical states are assumed by the Atox1.
24800945 NSC73306 is a transport substrate of CTR1
24792335 CTR1 expression may be necessary for therapeutic efficacy of platinum based drugs in non-small cell lung cancer treatment.
24703712 Data suggest that SLC31A1 and SLC31A2, despite being structurally closely related and sharing important amino acid motifs, play different roles in copper homeostasis and in platinum-based chemotherapy of neoplasms. [REVIEW]
More...

AA Sequence

MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMA      1 - 70
GAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHI     71 - 140
IQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH                        141 - 190
//

Text Mined References (66)

PMID Year Title
26851002 2016 Copper Transporter-CTR1 Expression and Pathological Outcomes in Platinum-treated Muscle-invasive Bladder Cancer Patients.
26745413 2016 The C-Terminus of Human Copper Importer Ctr1 Acts as a Binding Site and Transfers Copper to Atox1.
26205368 2015 The copper transporter 1 (CTR1) is required to maintain the stability of copper transporter 2 (CTR2).
26067577 2015 Copper uptake by DMT1: a compensatory mechanism for CTR1 deficiency in human umbilical vein endothelial cells.
26061257 2015 Self-Assembly of the Second Transmembrane Domain of hCtr1 in Micelles and Interaction with Silver Ion.
25823781 2015 Human OCT2 variant c.808G>T confers protection effect against cisplatin-induced ototoxicity.
24837030 2014 Probing the structural flexibility of the human copper metallochaperone Atox1 dimer and its interaction with the CTR1 c-terminal domain.
24800945 2014 Uptake of compounds that selectively kill multidrug-resistant cells: the copper transporter SLC31A1 (CTR1) increases cellular accumulation of the thiosemicarbazone NSC73306.
24792335 2014 Copper transporter CTR1 expression and tissue platinum concentration in non-small cell lung cancer.
24703712 2015 The role of Ctr1 and Ctr2 in mammalian copper homeostasis and platinum-based chemotherapy.
More...