Property Summary

NCBI Gene PubMed Count 68
PubMed Score 95.61
PubTator Score 185.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.200 4.6e-03
ovarian cancer 2.400 5.4e-06
pancreatic cancer 1.100 3.8e-03
pancreatic carcinoma 1.100 3.8e-03
pancreatic ductal adenocarcinoma liver m... -1.752 7.1e-04
subependymal giant cell astrocytoma 1.111 3.4e-02

 GWAS Trait (1)

Gene RIF (60)

AA Sequence

MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMA      1 - 70
GAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHI     71 - 140
IQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH                        141 - 190
//

Text Mined References (72)

PMID Year Title