Property Summary

NCBI Gene PubMed Count 2
PubMed Score 522.83
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MADEEKLPPGWEKRMSRPSGRGYYFNHITNPSQWERPSGNSSSGGKIWQGEPARVRRSHLLVKPVKAALD      1 - 70
LAAGNHPDQGGGPGADQRLHPEDQGRREGL                                             71 - 100
//

Text Mined References (3)

PMID Year Title