Property Summary

NCBI Gene PubMed Count 20
PubMed Score 17.31
PubTator Score 76.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
periodontitis 269 1.62564896440655E-23
breast carcinoma 1614 3.56972031909974E-18
glioblastoma multiforme 347 1.78605794186744E-13
non-small cell lung cancer 2798 6.1027825811728E-9
malignant mesothelioma 3163 7.08645566277996E-8
lung adenocarcinoma 2714 1.79495566701624E-7
pancreatic cancer 2300 2.03420932879617E-7
tuberculosis and treatment for 6 months 686 2.15260185716512E-5
posterior fossa group A ependymoma 1511 5.88767499850613E-5
invasive ductal carcinoma 2950 8.46442234092697E-5
inflammatory breast cancer 404 1.12051854816389E-4
Atopic dermatitis 944 1.19232704738077E-4
juvenile dermatomyositis 1189 1.50285034383503E-4
cutaneous lupus erythematosus 1056 1.7038446068062E-4
pediatric high grade glioma 2712 3.31856071652704E-4
psoriasis 6685 4.05285813384972E-4
ovarian cancer 8492 4.56958843456694E-4
colon cancer 1475 7.34970118167788E-4
ductal carcinoma in situ 1745 0.00125302236024029
group 4 medulloblastoma 1875 0.00172778685686851
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00371079704990415
lung cancer 4473 0.00502711058218405
pituitary cancer 1972 0.00587653119775156
acute quadriplegic myopathy 1157 0.00945204527980953
primary pancreatic ductal adenocarcinoma 1271 0.0170838678726433
Duchenne muscular dystrophy 602 0.0172878875412693
gastric carcinoma 832 0.0181506847577788
active ulcerative colitis 477 0.0212260120914893
osteosarcoma 7933 0.0246515524432556
Endometriosis 535 0.0253867318279721
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0309866441193296

Expression

Synonym

Accession O15427 B3KXG8 Q2M1P8 MCT 4
Symbols MCT3
MCT4
MCT 3
MCT 4
MCT-3
MCT-4

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20035863 Ocular absorption of monocarboxylic acid drugs may be enhanced by MCT transporter SLC16A3, and the absorption route provided by the transporter may be utilized to improve the bioavailability of topically applied ophthalmic drugs.
19913121 Observational study of gene-disease association. (HuGE Navigator)
17502341 Gamma-hydroxybutyric acid (GHB) is a substrate for both MCT2 and MCT4.

AA Sequence

MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDTAWISSILLAM      1 - 70
LYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIMLNRY     71 - 140
FSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRPLVVTAQPGSGP    141 - 210
PRPSRRLLDLSVFRDRGFVLYAVAASVMVLGLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPA    211 - 280
AGFVAGLGKVRPYSVYLFSFSMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTH    281 - 350
KFSSAIGLVLLMEAVAVLVGPPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE    351 - 420
VAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV                             421 - 465
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20035863 2010 Monocarboxylate transport in human corneal epithelium and cell lines.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...