Property Summary

Ligand Count 3
NCBI Gene PubMed Count 21
PubMed Score 17.86
PubTator Score 76.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
active ulcerative colitis 1.946 2.1e-02
acute quadriplegic myopathy -1.396 1.5e-02
Atopic dermatitis 1.500 1.2e-04
autosomal dominant Emery-Dreifuss muscul... -1.427 3.9e-02
Breast cancer 1.900 8.2e-08
breast carcinoma 1.100 1.1e-02
colon cancer 1.300 7.3e-04
cutaneous lupus erythematosus 1.500 3.0e-04
Duchenne muscular dystrophy -1.030 1.9e-02
ductal carcinoma in situ 1.500 1.3e-03
Endometriosis -1.099 2.2e-02
ependymoma 1.200 2.8e-03
gastric carcinoma 2.100 1.8e-02
glioblastoma 1.200 7.3e-03
group 4 medulloblastoma -1.800 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.700 3.7e-03
invasive ductal carcinoma 1.209 9.3e-04
juvenile dermatomyositis -1.080 1.5e-04
lung adenocarcinoma 1.600 1.8e-07
lung cancer 1.100 5.0e-03
malignant mesothelioma -2.200 7.1e-08
non-small cell lung cancer 1.282 6.1e-09
osteosarcoma 1.650 2.5e-02
ovarian cancer 2.400 4.6e-04
pancreatic cancer 1.800 3.3e-06
pancreatic ductal adenocarcinoma liver m... 1.726 4.9e-03
pediatric high grade glioma 1.900 3.3e-04
periodontitis 1.100 1.6e-23
pituitary cancer -1.300 5.9e-03
psoriasis -1.100 4.1e-04
tuberculosis -1.800 5.6e-06

Synonym

Accession O15427 B3KXG8 Q2M1P8 MCT 4
Symbols MCT3
MCT4
MCT 3
MCT 4
MCT-3
MCT-4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDTAWISSILLAM      1 - 70
LYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIMLNRY     71 - 140
FSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRPLVVTAQPGSGP    141 - 210
PRPSRRLLDLSVFRDRGFVLYAVAASVMVLGLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPA    211 - 280
AGFVAGLGKVRPYSVYLFSFSMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTH    281 - 350
KFSSAIGLVLLMEAVAVLVGPPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE    351 - 420
VAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV                             421 - 465
//

Text Mined References (28)

PMID Year Title