Property Summary

NCBI Gene PubMed Count 106
Grant Count 107
R01 Count 59
Funding $17,611,153.92
PubMed Score 292.20
PubTator Score 240.03

Knowledge Summary

Patent

No data available

Expression

Gene

PDB

2AS5   2A07  

 GO Component (1)

 IMPC Term (2)

Gene RIF (93)

PMID Text
27064276 Genetic variants in FOXP2 may be significant for rare forms of language impairment, they do not contribute appreciably to individual variation in the normal range as found in the general population.
26950495 Data suggest FOXP2 binds DNA as monomer; FOXP2 hinge loop domain mutants exhibit either decreased formation of homodimer (A539P) or decreased dissociation of homodimer (F541C); naturally occurring reverse mutation (P539A) increases DNA binding affinity.
26497390 CNTNAP2 is transcriptionally regulated by FOXP2.
26212494 FOXP2 is a substrate for SUMOylation and SUMOylation of FOXP2 plays a functional role in regulating its transcriptional activity.
26142732 Our results suggested that FOXP2 expression was downregulated in Hepatocellular carcinoma tumor tissues, and reduced FOXP2 expression was associated with poor overall survival
26055196 pH had a direct effect on FOXP2 binding to DNA affinity.
25995468 FOXP2 SNPs influence the use of speech sound learning strategies.
25848863 FOXF2 deficiency enhances metastatic ability of BLBC cells by activating the EMT program through upregulating the transcription of TWIST1.
25515522 repression of expression is a feature of aggressive breast cancer, and an independent prognostic parameter for overall patient survival
25472883 HIV-1 Tat specifically associates with FOXP2 promoter to upregulate FOXP2 expression in T cells
More...

AA Sequence

MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQT      1 - 70
SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK     71 - 140
KQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGKQAKEQQQQQQQQQQL    141 - 210
AAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSME    211 - 280
DNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKW    281 - 350
PGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP    351 - 420
KPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSE    421 - 490
IAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHK    491 - 560
CFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLI    561 - 630
NNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELE    631 - 700
DDREIEEEPLSEDLE                                                           701 - 715
//

Text Mined References (106)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27064276 2016 Common Genetic Variants in FOXP2 Are Not Associated with Individual Differences in Language Development.
26950495 2016 A Key Evolutionary Mutation Enhances DNA Binding of the FOXP2 Forkhead Domain.
26647308 2016 Identification and functional characterization of de novo FOXP1 variants provides novel insights into the etiology of neurodevelopmental disorder.
26497390 2015 Contactin?associated protein?like 2 expression in SH?SY5Y cells is upregulated by a FOXP2 mutant with a shortened poly?glutamine tract.
26212494 2016 The Key Regulator for Language and Speech Development, FOXP2, is a Novel Substrate for SUMOylation.
26142732 2015 Downregulation of FOXP2 promoter human hepatocellular carcinoma cell invasion.
26055196 2015 Effect of pH on the Structure and DNA Binding of the FOXP2 Forkhead Domain.
25995468 2015 Enhanced procedural learning of speech sound categories in a genetic variant of FOXP2.
25848863 2015 FOXF2 deficiency promotes epithelial-mesenchymal transition and metastasis of basal-like breast cancer.
More...