Property Summary

NCBI Gene PubMed Count 59
Grant Count 7
R01 Count 4
Funding $4,026,025.66
PubMed Score 40.74
PubTator Score 52.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (46)

PMID Text
26911390 TNRC9 GG genotype of rs3803662 is associated with increased breast cancer risk.
26239137 The TOX3 SNPs rs3803662 C > T, rs12443621 A > G and rs8051542 C > T were all correlated with increased risk of breast cancer in the European and Asian populations, but not in the African one.
26224856 data suggest that central inhibition of IL-1alpha or Tox3 overexpression during the acute phase of a CNS insult may be an effective means for preventing the loss of neurological function
25956309 TOX3 and FGFR2 are breast cancer susceptibility genes in BRCA1/2-wild-type breast cancer patients from Sardinian population.
25632947 TOX3 is expressed in mammary ER(+) epithelial cells and regulates ER target genes in luminal breast cancer
25531440 Single nucleotide polymorphism in TOX3 gene is associated with breast cancer risk.
25311971 Mutations in TOX3 are not common in Chinese Han women with polycystic ovary syndrome.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
24532140 These results indicate an additive effect of the TOX3 rs3803662 and 2q35 rs13387042 alleles for breast cancer risk.
24481062 The T-rs8051542 allele was significantly associated with ER-positive and HER2-negative carriers. No significant association existed between rs12443621, rs3803662, and rs3112612 polymorphisms and risk of breast cancer.
More...

AA Sequence

MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPIT      1 - 70
PPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSH     71 - 140
TQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQSQLSAQLGLNLGGASMPHTSPSPPASKSATP    141 - 210
SPSSSINEEDADEANRAIGEKRAAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNA    211 - 280
TFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLAST    281 - 350
NLTSSLLLNTPLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG    351 - 420
TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQHFQHHMQQHL    421 - 490
QQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQITSPIPAIGSPQPASQQHQSQ    491 - 560
IQSQTQTQVLSQVSIF                                                          561 - 576
//

Text Mined References (60)

PMID Year Title
26911390 2016 TNRC9 rs12443621 and FGFR2 rs2981582 polymorphisms and breast cancer risk.
26239137 2015 Association of three SNPs in TOX3 and breast cancer risk: Evidence from 97275 cases and 128686 controls.
26224856 2015 IL-1? Gene Deletion Protects Oligodendrocytes after Spinal Cord Injury through Upregulation of the Survival Factor Tox3.
25956309 2015 Genome-wide association study of susceptibility loci for breast cancer in Sardinian population.
25632947 2015 TOX3 is expressed in mammary ER(+) epithelial cells and regulates ER target genes in luminal breast cancer.
25531440 2014 Associations of two common genetic variants with breast cancer risk in a chinese population: a stratified interaction analysis.
25327703 2014 Genome-wide association study of breast cancer in Latinas identifies novel protective variants on 6q25.
25311971 2014 Mutational analysis of TOX3 in Chinese Han women with polycystic ovary syndrome.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
24532140 2014 Association of genetic variants at TOX3, 2q35 and 8q24 with the risk of familial and early-onset breast cancer in a South-American population.
More...