Property Summary

NCBI Gene PubMed Count 63
PubMed Score 43.27
PubTator Score 52.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Breast cancer 2.300 2.8e-02
Astrocytoma, Pilocytic -2.100 9.7e-03
breast carcinoma 1.300 1.6e-06
colon cancer -3.000 1.4e-02
cystic fibrosis -1.200 4.7e-04
ductal carcinoma in situ 3.400 9.5e-03
esophageal adenocarcinoma 3.000 1.9e-02
intraductal papillary-mucinous adenoma (... 2.400 5.6e-03
intraductal papillary-mucinous carcinoma... 1.900 4.9e-02
intraductal papillary-mucinous neoplasm ... 2.600 2.8e-02
invasive ductal carcinoma 3.600 1.1e-03
lung adenocarcinoma 1.700 4.2e-10
lung cancer 1.600 2.3e-03
lung carcinoma 2.500 5.1e-25
medulloblastoma 2.100 1.4e-03
nasopharyngeal carcinoma -1.400 1.3e-02
non-small cell lung cancer 1.341 4.6e-04
oligodendroglioma 1.200 1.1e-03
pancreatic cancer 1.900 1.4e-05
pituitary cancer -3.600 6.1e-05
posterior fossa group A ependymoma -1.900 6.6e-04
psoriasis -1.100 2.7e-03

Gene RIF (50)

AA Sequence

MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPIT      1 - 70
PPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSH     71 - 140
TQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQSQLSAQLGLNLGGASMPHTSPSPPASKSATP    141 - 210
SPSSSINEEDADEANRAIGEKRAAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNA    211 - 280
TFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLAST    281 - 350
NLTSSLLLNTPLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG    351 - 420
TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQHFQHHMQQHL    421 - 490
QQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQITSPIPAIGSPQPASQQHQSQ    491 - 560
IQSQTQTQVLSQVSIF                                                          561 - 576
//

Text Mined References (64)

PMID Year Title