Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.99
PubTator Score 5.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 2.932 7.4e-11
adult high grade glioma -1.100 7.9e-03
Amyotrophic lateral sclerosis 1.064 1.1e-05
Astrocytoma, Pilocytic -1.100 1.3e-02
breast carcinoma 1.100 3.0e-04
facioscapulohumeral dystrophy 2.600 3.6e-06
glioblastoma -1.100 4.0e-02
interstitial cystitis 1.400 2.9e-03
invasive ductal carcinoma 1.827 2.8e-03
medulloblastoma, large-cell -1.500 2.4e-03
mucosa-associated lymphoid tissue lympho... 1.488 1.6e-02
non-small cell lung cancer -1.461 7.1e-10
osteosarcoma -3.077 1.4e-04
ovarian cancer 1.100 7.6e-03
pancreatic cancer 1.300 1.5e-03
primitive neuroectodermal tumor -1.500 2.0e-03
progressive supranuclear palsy -1.200 7.2e-03
psoriasis 1.200 2.6e-23
tuberculosis -1.300 1.5e-02
ulcerative colitis 1.600 5.1e-03

Gene RIF (3)

AA Sequence

MTQNKLKLCSKANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSRISWIISIC      1 - 70
VFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQEVSHMYVAIGIISGLGYCFSFLPTVTIL     71 - 140
SQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPAS    141 - 210
PKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKK    211 - 280
APLLDFSILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFV    281 - 350
LNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSS    351 - 420
AAGVYIFIQSIAGLAGPPLAGLLVDQSKIYSRAFYSCAAGMALAAVCLALVRPCKMGLCQHHHSGETKVV    421 - 490
SHRGKTLQDIPEDFLEMDLAKNEHRVHVQMEPV                                         491 - 523
//

Text Mined References (9)

PMID Year Title