Property Summary

NCBI Gene PubMed Count 40
PubMed Score 18.20
PubTator Score 23.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.200 0.001
osteosarcoma -3.495 0.000
glioblastoma -1.100 0.001
medulloblastoma, large-cell -2.200 0.000
non-small cell lung cancer -1.072 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.030
lung cancer 1.400 0.011
invasive ductal carcinoma -1.100 0.004
ovarian cancer -2.100 0.000

Synonym

Accession O15400 E1P579 Q5SZW2 Q96ES9
Symbols

Gene

Gene RIF (9)

PMID Text
24173214 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
24173214 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
21438968 Data suggest that accumulation of recycling T cell receptors at the immunological synapse is SNARE-dependent and that Stx7-mediated processing of recycling TCRs through endosomes is a prerequisite for the cytolytic function of cytotoxic T lymphocytes.
20170677 data reveal the presence of syntaxin 7 in the membranes of exocytosis-prone granules and phagocytosis-related granules in human neutrophils, and therefore it might play a role in both exocytosis and phagocytosis in human neutrophils
19714869 The expression level of STX7 protein was inversely correlated to tumor stage, suggesting that decreased expression of STX7 is associated with more aggressive tumors.
18980942 Palmitoylation-defective syntaxin 7 is selectively retained on the plasma membrane, suggesting that palmitoylation is important for intercompartmental transport of syntaxin 7.
18570918 Results report that syntaxin 7, syntaxin 8, vti1b and VAMP8 physically and functionally interact with CFTR.
18198266 Observational study of gene-disease association. (HuGE Navigator)
12730232 syntaxin 7 has a role in the intracellular vacuolation induced by VacA

AA Sequence

MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYI      1 - 70
KEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKER     71 - 140
NLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANV    141 - 210
ENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVAIISLIIWGLNH                       211 - 261
//

Text Mined References (50)

PMID Year Title
26101353 2015 ?-SNAP stimulates disassembly of endosomal SNARE complexes and regulates endocytic trafficking pathways.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24550300 2014 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...