Property Summary

NCBI Gene PubMed Count 38
Grant Count 69
R01 Count 36
Funding $6,877,477.54
PubMed Score 122.78
PubTator Score 48.19

Knowledge Summary

Patent (5,248)

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.600 0.033
posterior fossa group B ependymoma -1.200 0.000
ovarian cancer 1.100 0.000

Synonym

Accession O15399 GluN2D
Symbols EB11
NR2D
EIEE46
GluN2D
NMDAR2D

Gene

Gene RIF (52)

PMID Text
25760043 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25613138 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24739951 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24086760 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23665428 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23267846 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22940423 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22833210 Absence of truncating mutation in GRIN1 and GRIN2D genes in patients with autism spectrum disorder and schizophrenia and controls.
22552781 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22486492 After 7 days of chronic alcohol exposure, there are significant increases in mRNA expression of GRIN2D in cultured neurons derived from alcoholic subjects, but not in cultures from nonalcoholics.
More...

AA Sequence

MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGPAYAAEAARLG      1 - 70
PAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSRAPAVAPILDFLSAQTSLP     71 - 140
IVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYDWTSFVAVTTRAPGHRAFLSYIEVLTDG    141 - 210
SLVGWEHRGALTLDPGAGEAVLSAQLRSVSAQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLA    211 - 280
GGGGSGAPGEPPLLPGGAPLPAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRA    281 - 350
QNRTHRGESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG    351 - 420
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRCCKGFCID    421 - 490
ILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETG    491 - 560
ISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIG    561 - 630
KSIWLLWALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQR    631 - 700
PQEQYPPLKFGTVPNGSTEKNIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKD    701 - 770
EGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL    771 - 840
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAPPPAKPPP    841 - 910
PPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADGFHRYYGPIEPQGLGLGLGEA    911 - 980
RAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPPAGAFPGFPSPPAPPAAAATAVGPPLCRLAF    981 - 1050
EDESPPAPARWPRSDPESQPLLGPGAGGAGGTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSES   1051 - 1120
LGGASLGGLEPWWFADFPYPYAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLP   1121 - 1190
PPRHLSCSHDGLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW   1191 - 1260
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFS   1261 - 1330
SLESEV                                                                   1331 - 1336
//

Text Mined References (40)

PMID Year Title
27616483 2016 GRIN2D Recurrent De Novo Dominant Mutation Causes a Severe Epileptic Encephalopathy Treatable with NMDA Receptor Channel Blockers.
22833210 2011 Rare mutations in N-methyl-D-aspartate glutamate receptors in autism spectrum disorders and schizophrenia.
22486492 2012 Pilot study of iPS-derived neural cells to examine biologic effects of alcohol on human neurons in vitro.
21915661 2011 [Chromosomal instability, microsatellite instability and CpG island methylator phenotype: roles in small intestinal carcinogenesis].
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19125103 2009 Association analysis of the glutamic acid decarboxylase 2 and the glutamine synthetase genes (GAD2, GLUL) with schizophrenia.
18444252 2008 Neurotransmission and bipolar disorder: a systematic family-based association study.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16328341 2006 Cultivated keratinocytes express N-methyl-D-aspartate receptors of the NMDAR2D type.
More...