Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.97
PubTator Score 12.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession O15394 A8MQ06 B7Z841 Q7Z7F2 N-CAM-2
Symbols NCAM21

Gene

PDB

2DOC   2JLL   2KBG   2V5T   2VAJ   2WIM   2XY1   2XY2   2XYC  

Gene RIF (8)

PMID Text
26611261 Abeta-dependent disruption of NCAM2 functions in Alzheimer's disease hippocampus contributes to synapse loss.
21300289 A complete structural model of the entire ectodomain of human NCAM2 has been assembled from crystal structures of six recombinant proteins corresponding to different regions of the ectodomain.
21214674 High NCAM2 is associated with increased 5-Fluorouracil sensitivity in prostate and breast cancer.
20932310 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029409 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18706912 In the crystal structure, two Ig domains interact by domain swapping, as the two N-terminal beta-strands are interchanged.

AA Sequence

MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQ      1 - 70
KEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSS     71 - 140
SPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPA    141 - 210
ISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYV    211 - 280
CRATNKAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSL    281 - 350
DGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI    351 - 420
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYIL    421 - 490
ALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLE    491 - 560
PNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKY    561 - 630
RSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLG    631 - 700
LGAVIGLGVAALLLILVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIV    701 - 770
EMRTEDERVTNHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA       771 - 837
//

Text Mined References (20)

PMID Year Title
26611261 2015 A?-dependent reduction of NCAM2-mediated synaptic adhesion contributes to synapse loss in Alzheimer's disease.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21300289 2011 Structural model and trans-interaction of the entire ectodomain of the olfactory cell adhesion molecule.
21214674 2011 Neural cell adhesion molecule 2 as a target molecule for prostate and breast cancer gene therapy.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
More...