Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.63
PubTator Score 12.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Obesity 678 0.0 3.0
Disease Target Count Z-score Confidence
Mucositis 29 3.071 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.4e-05
ependymoma -1.400 3.6e-05
glioblastoma multiforme -1.300 4.5e-27
lung carcinoma -2.000 3.0e-19
malignant mesothelioma -2.500 3.5e-07
medulloblastoma -1.200 1.2e-02
medulloblastoma, large-cell -2.000 1.6e-06
osteosarcoma -1.014 3.5e-04
primitive neuroectodermal tumor -1.100 5.3e-03

Gene RIF (9)

AA Sequence

MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQ      1 - 70
KEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSS     71 - 140
SPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPA    141 - 210
ISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYV    211 - 280
CRATNKAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSL    281 - 350
DGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI    351 - 420
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYIL    421 - 490
ALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLE    491 - 560
PNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKY    561 - 630
RSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLG    631 - 700
LGAVIGLGVAALLLILVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIV    701 - 770
EMRTEDERVTNHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA       771 - 837
//

Text Mined References (24)

PMID Year Title