Property Summary

NCBI Gene PubMed Count 142
PubMed Score 408.69
PubTator Score 388.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 7.95645919593272E-49
psoriasis 6685 4.05832561412406E-22
non-small cell lung cancer 2798 3.67712623963654E-12
ovarian cancer 8492 2.16764708847169E-9
osteosarcoma 7933 8.52486648275131E-8
Breast cancer 3099 4.51192215678621E-7
lung adenocarcinoma 2714 8.23492730765393E-7
nasopharyngeal carcinoma 1056 5.40438460362716E-6
interstitial cystitis 2299 1.90862589135466E-5
lung cancer 4473 3.15206386279433E-5
medulloblastoma, large-cell 6234 1.68924178059642E-4
adult high grade glioma 2148 0.00158746279059501
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00278001018350946
gastric carcinoma 832 0.0399415993706637

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma 1.670 0.000
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer -1.884 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.003
lung cancer -3.700 0.000
interstitial cystitis -3.300 0.000
lung adenocarcinoma -1.500 0.000
adult high grade glioma 1.100 0.002
nasopharyngeal carcinoma -1.300 0.000
Breast cancer -1.400 0.000
lung carcinoma -4.400 0.000
gastric carcinoma -1.900 0.040
ovarian cancer 1.700 0.000
psoriasis -1.400 0.000

Synonym

Accession O15393 A8K6Z8 B2R8E5 B7Z459 D3DSJ2 F8WES1 Q6GTK7 Q9BXX1
Symbols PP9284
PRSS10

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (122)

PMID Text
27028521 the type II transmembrane serine protease TMPRSS2 was able to activate hemagglutinin for cell entry indicating that bat influenza A virus can utilize human proteases for hemagglutinin activation.
26978019 The relatively low rate of ERG-positive prostatic intraepithelial neoplasia counts in favor of the limited role of chimeric transcript TMPRSS2/ERG in the differential diagnosis of prostatic intraepithelial neoplasia
26615022 The potential for TMPRSS2:ERG gene fusion, detected by IHC, to modify the role of PTEN loss in lethal progression of prostate cancer.
26503111 Aspirin was associated with a significant reduction in the relative risk of TMPRSS2:ERG (T2E )fusion positive, but not T2E negative
26424596 Results indicate that PTEN loss occurs in cooperation with TMPRSS2-ERG fusion in prostate cancer and the majority of the samples harbor TMPRSS2-ERG fusion as well as PTEN gene deletion.
26379044 TMPRSS2 isoform 1 is expressed in viral target cells.
26251449 Membrane bound meprin Beta is activated by transmembrane serine protease matriptase-2 at the cell surface.
26026052 The TMPRSS2-ERG Gene Fusion Blocks XRCC4-Mediated Nonhomologous End-Joining Repair and Radiosensitizes Prostate Cancer Cells to PARP Inhibition
26018085 TMPRSS2 promotes the growth, invasion, and metastasis of prostate cancer cells via matriptase activation and extracellular matrix disruption.
25977336 Analysis of prostate cancer tissues showed that the presence of a TMPRSS2-ERG rearrangement was highly correlated with lower levels of NKX3.1 expression consistent with the role of NKX3.1 as a suppressor of the pathogenic gene rearrangement.
More...

AA Sequence

MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPK      1 - 70
SPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCP     71 - 140
GGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFM    141 - 210
KLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHV    211 - 280
CGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMK    281 - 350
LQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI    351 - 420
TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRA    421 - 490
DG                                                                        491 - 492
//

Text Mined References (145)

PMID Year Title
27028521 2016 The Hemagglutinin of Bat-Associated Influenza Viruses Is Activated by TMPRSS2 for pH-Dependent Entry into Bat but Not Human Cells.
26978019 [Diagnostic value of estimation of ERG expression in prostate adenocarcinoma and high-grade prostatic intraepithelial neoplasia].
26615022 2016 A Prospective Investigation of PTEN Loss and ERG Expression in Lethal Prostate Cancer.
26503111 2016 Aspirin and NSAID use in association with molecular subtypes of prostate cancer defined by TMPRSS2:ERG fusion status.
26424596 2016 Frequency of PTEN alterations, TMPRSS2-ERG fusion and their association in prostate cancer.
26379044 2015 TMPRSS2 Isoform 1 Activates Respiratory Viruses and Is Expressed in Viral Target Cells.
26251449 2015 Metalloprotease meprin ? is activated by transmembrane serine protease matriptase-2 at the cell surface thereby enhancing APP shedding.
26026052 2015 The TMPRSS2-ERG Gene Fusion Blocks XRCC4-Mediated Nonhomologous End-Joining Repair and Radiosensitizes Prostate Cancer Cells to PARP Inhibition.
26018085 2015 Androgen-Induced TMPRSS2 Activates Matriptase and Promotes Extracellular Matrix Degradation, Prostate Cancer Cell Invasion, Tumor Growth, and Metastasis.
25977336 2015 NKX3.1 Suppresses TMPRSS2-ERG Gene Rearrangement and Mediates Repair of Androgen Receptor-Induced DNA Damage.
More...