Property Summary

Ligand Count 20
NCBI Gene PubMed Count 1,081
PubMed Score 132.54
PubTator Score 801.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cancer 2499 4.645 2.3

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 2.407 5.5e-05
adult high grade glioma 2.000 3.6e-05
Atopic dermatitis 1.700 2.0e-04
atypical teratoid / rhabdoid tumor 2.500 9.0e-10
Breast cancer 2.400 4.1e-02
breast carcinoma 2.000 2.9e-04
colon cancer 1.700 9.7e-04
ductal carcinoma in situ 2.600 4.1e-04
Endometriosis 1.718 1.5e-02
ependymoma 1.800 1.0e-06
glioblastoma 2.100 2.0e-08
group 3 medulloblastoma 3.600 2.5e-06
intraductal papillary-mucinous carcinoma... 2.400 2.2e-05
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-02
invasive ductal carcinoma 2.000 2.2e-05
lung adenocarcinoma 2.900 4.6e-11
lung cancer 3.700 6.2e-06
medulloblastoma, large-cell 3.800 5.2e-07
nasopharyngeal carcinoma 1.400 5.7e-05
non-small cell lung cancer 2.691 6.8e-28
osteosarcoma -1.803 2.8e-02
ovarian cancer 1.800 1.2e-08
pancreatic cancer 1.200 6.5e-05
primitive neuroectodermal tumor 2.800 1.4e-04
psoriasis 1.300 8.7e-06
tuberculosis 1.300 3.0e-04

Gene RIF (1041)

AA Sequence

MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD      1 - 70
DDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAA     71 - 140
MD                                                                        141 - 142
//

Text Mined References (1088)

PMID Year Title