Property Summary

NCBI Gene PubMed Count 1,020
Grant Count 5
Funding $447,163
PubMed Score 120.74
PubTator Score 801.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O15392 A2SUH6 B2R4R1 Q2I3N8 Q4VGX0 Q53F61 Q5MGC6 Q6FHL2 Q75SP2 Q9P2W8
Symbols API4
EPR-1

Gene

PANTHER Protein Class (2)

PDB

2QFA   2RAW   2RAX   4A0I   1E31   1F3H   1XOX   3UEC   3UED   3UEE   3UEF   3UEG   3UEH   3UEI   3UIG   3UIH   3UII   3UIJ   3UIK   4A0J   4A0N  

Gene RIF (984)

PMID Text
26978233 Expression of Caspase 3, including that of survivin, was significantly more frequently detected in the patients who had received combined cytotoxic and anti-VEGF therapy as compared to both those treated with only cytotoxic agents and the control group
26944315 Nuclear accumulation of YAP could promote the survival of senescent cells by increasing survivin expression.
26896649 Data show that down regulation of survivin gene in HO8910PM cells with small interference RNA (siRNA) resulted in increased sensitivity to S-allylmercaptocysteine (SAMC) together with a decrease in invasiveness of tumor cells.
26832409 Survivin is a key regulator of gut tissue integrity by regulating epithelial homeostasis in the stem cell niche.
26828978 It also inhibits the mRNA levels of Survivin gene.
26823716 Expression of livin, survivin and caspase-3 are closely related to the occurrence and development of prostatic cancer.
26815661 The expressions of survivin and cycline D1 are positively correlated with the malignant potential of mucinous ovarian neoplasms.
26771605 Survivin is a key gene for regulating squamous cell carcinoma (SCC) cancer stem cell formation and cancer SCC development.
26723509 MiR-542-3p and its target gene survivin may play crucial roles in the aggressive progression of human bladder cancer.
26718651 Overexpression of miR494 and silencing survivin RNA through the use of survivin shRNA inhibited the expression of survivin and attenuated PC3 cell growth in vitro and in vivo.
More...

AA Sequence

MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD      1 - 70
DDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAA     71 - 140
MD                                                                        141 - 142
//

Text Mined References (1026)

PMID Year Title
26978233 [Impact of preoperative drug therapy on the expression of apoptosis markers in colorectal liver metastases].
26944315 2016 Nuclear accumulation of Yes-Associated Protein (YAP) maintains the survival of doxorubicin-induced senescent cells by promoting survivin expression.
26896649 2016 Over-expression of survivin is a factor responsible for differential responses of ovarian cancer cells to S-allylmercaptocysteine (SAMC).
26832409 2016 Loss of Survivin in Intestinal Epithelial Progenitor Cells Leads to Mitotic Catastrophe and Breakdown of Gut Immune Homeostasis.
26828978 2016 Protective effect of Honokiol against endometriosis in Rats via attenuating Survivin and Bcl-2: A mechanistic study.
26823716 2015 Expression of livin, survivin and caspase-3 in prostatic cancer and their clinical significance.
26815661 2016 Survivin and cycline D1 expressions are associated with malignant potential in mucinous ovarian neoplasms.
26771605 2016 Survivin Modulates Squamous Cell Carcinoma-Derived Stem-Like Cell Proliferation, Viability and Tumor Formation in Vivo.
26723509 2016 MicroRNA-542-3p suppresses cellular proliferation of bladder cancer cells through post-transcriptionally regulating survivin.
26718651 2016 Targeting survivin using a combination of miR?494 and survivin shRNA has synergistic effects on the suppression of prostate cancer growth.
More...