Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $8,228.78
PubMed Score 11.46
PubTator Score 8.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (5)

PMID Text
22248057 article summarizes all critical aspects that are (or will be) relevant for a better understanding of YY1- and/or YY2-mediated cellular control mechanisms
20215434 Results show that human YY2 is not redundant to YY1, and YY2 is a significant regulator of genes previously identified as uniquely responding to YY1.
19026728 yy2 expression is mediated by its own methylation-sensitive promoter.
16260628 the novel factor YY2 antagonizes the negative actions exerted by YY1
15087442 YY2 can bind to and regulate some promoters known to be controlled by YY1. Similar to YY1, YY2 contains both transcriptional activation and repression functions.

AA Sequence

MASNEDFSITQDLEIPADIVELHDINVEPLPMEDIPTESVQYEDVDGNWIYGGHNHPPLMVLQPLFTNTG      1 - 70
YGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKK     71 - 140
PSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTLEGEFSVTMWSPNDNNDQGAVGEGQAENPPDY    141 - 210
SEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGP    211 - 280
RVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNR    281 - 350
KFAQSTNLKTHILTHVKTKNNP                                                    351 - 372
//

Text Mined References (14)

PMID Year Title
22248057 2011 Yin Yang 2: the great unknown within the Yin Yang 1 regulatory network.
20215434 2010 Genome-wide analysis of YY2 versus YY1 target genes.
19026728 2009 Transcriptional activity of the novel identified human yy2 promoter is modified by DNA methylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17478514 2007 Retroposition and evolution of the DNA-binding motifs of YY1, YY2 and REX1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16377127 2006 Rapid evolution of a recently retroposed transcription factor YY2 in mammalian genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260628 2005 Enhanceosome formation over the beta interferon promoter underlies a remote-control mechanism mediated by YY1 and YY2.
15772651 2005 The DNA sequence of the human X chromosome.
More...