Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.49
PubTator Score 8.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (6)

AA Sequence

MASNEDFSITQDLEIPADIVELHDINVEPLPMEDIPTESVQYEDVDGNWIYGGHNHPPLMVLQPLFTNTG      1 - 70
YGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKK     71 - 140
PSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTLEGEFSVTMWSPNDNNDQGAVGEGQAENPPDY    141 - 210
SEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGP    211 - 280
RVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNR    281 - 350
KFAQSTNLKTHILTHVKTKNNP                                                    351 - 372
//

Text Mined References (16)

PMID Year Title