Property Summary

Ligand Count 46
NCBI Gene PubMed Count 24
PubMed Score 64.72
PubTator Score 34.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
diabetes mellitus -1.100 2.0e-03
ependymoma 1.100 3.8e-02
gastric carcinoma -1.100 3.0e-02
interstitial cystitis -1.200 1.0e-02
intraductal papillary-mucinous adenoma (... -1.400 2.1e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.5e-02
ovarian cancer -1.200 1.3e-03
primary pancreatic ductal adenocarcinoma -1.059 1.3e-02
psoriasis 1.600 6.8e-05
ulcerative colitis -1.300 8.3e-07

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEW      1 - 70
NDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFD     71 - 140
KLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVS    141 - 210
LLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGV    211 - 280
LELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI    281 - 350
LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV                                351 - 392
//

Text Mined References (27)

PMID Year Title