Property Summary

NCBI Gene PubMed Count 24
Grant Count 43
R01 Count 40
Funding $4,041,262.43
PubMed Score 61.08
PubTator Score 34.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (8)

PMID Text
23043456 The mitochondrial isoform human brain BCAT 2 is largely confined to vascular endothelial cells, whereas the cytosolic human brain BCAT 1 is restricted to neurons.
22107788 BCATc (cytosolic) has an overall redox potential that is 30 mV lower than BCATm (mitochondrial). Furthermore, the CXXC motif of BCATc was estimated to be 80 mV lower, suggesting that BCATm is more oxidizing in nature.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19119849 The effect of nitric oxide modification on the functionality of human mitochondrial and cytosolic branched-chain aminotransferases (hBCATm and hBCATc, respectively) was investigated.
17050531 ption of the CXXC center results in altered substrate orientation and deprotonation of the amino group of pyridoxamine 5'-phosphate, which inhibits catalysis
15182179 role of cysteine residues in the regulatory CXXC motif
12269802 Studies of ketimine and pyridoxamine phosphate forms of BCAT@ reaction intermediates reveal substrate specificity for L-branched chain amino acids via a group of hydrophobic residues that form three hydrophobic surfaces and lock the side chain in place.
12119021 identification of a peroxide-sensitive redox switch at the CXXC motif

AA Sequence

MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEW      1 - 70
NDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFD     71 - 140
KLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVS    141 - 210
LLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGV    211 - 280
LELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI    281 - 350
LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV                                351 - 392
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23043456 2012 Distribution of the branched chain aminotransferase proteins in the human brain and their role in glutamate regulation.
22107788 2012 Differential redox potential between the human cytosolic and mitochondrial branched-chain aminotransferase.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19119849 2009 S-Nitrosoglutathione inactivation of the mitochondrial and cytosolic BCAT proteins: S-nitrosation and S-thiolation.
17050531 2006 Human mitochondrial branched chain aminotransferase isozyme: structural role of the CXXC center in catalysis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16141215 2005 Structural determinants for branched-chain aminotransferase isozyme-specific inhibition by the anticonvulsant drug gabapentin.
More...