Property Summary

NCBI Gene PubMed Count 21
PubMed Score 49.59
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.100 1.4e-10
cutaneous lupus erythematosus -1.100 7.1e-03
ductal carcinoma in situ 1.100 2.7e-04
group 3 medulloblastoma 1.900 1.4e-05
invasive ductal carcinoma 1.400 3.8e-03
ovarian cancer 1.400 1.3e-07
primitive neuroectodermal tumor 1.100 1.1e-03
ulcerative colitis -1.400 4.7e-07

Gene RIF (10)

AA Sequence

MKPRPAGFVDNKLKQRVIQYLTSNKCGKYVDIGVLASDLQRVYSIDYGRRKRNAFRIQVEKVFSIISSEK      1 - 70
ELKNLTELEDEHLAKRARQGEEDNEYTESYSDDDSSMEDYPDPQSANHMNSSLLSLYRKGNPDSVSNTPE     71 - 140
MEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPSVKKDSFFLDLSCEKSNPKKPITEIQDSKDS    141 - 210
SLLESDMKRKGKLKNKGSKRKKEDLQEVDGEIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKM    211 - 280
LIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELF    281 - 350
EQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPAL    351 - 420
RRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCREAAMCAVNRVL    421 - 490
MKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVAL    491 - 560
SSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTL    561 - 630
LAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVR    631 - 700
VVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPL    701 - 770
DADVNLEAIAGDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSIS    771 - 840
KKDQIMYERLQESLSR                                                          841 - 856
//

Text Mined References (29)

PMID Year Title