Property Summary

NCBI Gene PubMed Count 213
Grant Count 71
R01 Count 26
Funding $7,066,578.66
PubMed Score 132.19
PubTator Score 276.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 0.000

Synonym

Accession O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 HD3
Symbols HD3
RPD3
RPD3-2

Gene

PANTHER Protein Class (2)

PDB

4A69  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
485318 confirmatory 1 / 4 / 1408 Histone deacetylase 3 counterscreen for GASC1 inhibitors Measured in Biochemical System Using Plate Reader - 2043-03_Inhibitor_Dose_CherryPick
651916 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC3

Gene RIF (131)

PMID Text
26704017 this is the first report on the regulation mechanism of SIRT7 gene, in which, HDAC3 collaborated with C/EBPalpha to occupy its responding element in the upstream region of SIRT7 gene and repressed its expression in human cells.
26663086 Data suggest that complexes of HDAC3-H1.3 with NCOR1 and NCOR2/SMRT accumulate on chromatin in synchronized HeLa cells in late G2 phase and mitosis; deacetylation activity of HDAC3 is activated via phosphorylation of Ser-424 by CK2 only in mitosis.
26542778 Sequencing of HDAC3 revealed six single-nucleotide polymorphisms. The G allele of rs2530223 was significantly associated with the number of acute medications/month used and with the number of days/month in which medications were used
26531724 HDAC3 knockdown or HDAC3 inhibition was associated with simultaneous upregulation of the expression of miR130a and downregulation of the expression of TNF1alpha in peripheral blood mononuclear cells.
26450925 These data suggest that HDAC3 indirectly modulates tubulin acetylation
26420860 Data suggest, in chronic hepatitis C virus infection, HDAC9 (histone deacetylase 9) induction in liver regulates hepatic gluconeogenesis and systemic insulin resistance via deacetylation of FoxO1 (Forkhead box O 1) and HDAC3 (histone deacetylase 3).
26359372 Aberrant overexpression of HDACs in basal cells of IPF lungs may contribute to the bronchiolisation process in this disease. Similarly, generation and apoptosis resistance of IPF fibroblasts are mediated by enhanced activity of HDAC enzymes.
26305553 Among the class II HDACs, HDAC4 interacted with both MR and HDAC3 after aldosterone stimulation. The nuclear translocation of HDAC4 was mediated by protein kinase A (PKA) and protein phosphatases (PP)
25997740 miR-335 exerted apoptotic effects and inhibited ubiquitination of HDAC3 in anti-cancer drug-resistant cancer cell lines. miR-335 negatively regulated the invasion, migration, and growth rate of cancer cells.
25973054 These observations suggested that HDAC3 plays an important role in the pathological courses of spinal cord injury by regulating miR-130a expression
More...

AA Sequence

MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFL      1 - 70
QRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFE     71 - 140
ASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVG    141 - 210
AESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECV    211 - 280
EYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN    281 - 350
SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN    351 - 420
DKESDVEI                                                                  421 - 428
//

Text Mined References (221)

PMID Year Title
26704017 2016 C/EBP? negatively regulates SIRT7 expression via recruiting HDAC3 to the upstream-promoter of hepatocellular carcinoma cells.
26663086 2016 Mitotic Activation of a Novel Histone Deacetylase 3-Linker Histone H1.3 Protein Complex by Protein Kinase CK2.
26542778 2015 HDAC3 role in medication consumption in medication overuse headache patients: a pilot study.
26531724 2016 Role of histone deacetylase 3 in ankylosing spondylitis via negative feedback loop with microRNA-130a and enhancement of tumor necrosis factor-1? expression in peripheral blood mononuclear cells.
26450925 2015 Histone deacetylase 3 indirectly modulates tubulin acetylation.
26420860 2015 The Metabolic Regulator Histone Deacetylase 9 Contributes to Glucose Homeostasis Abnormality Induced by Hepatitis C Virus Infection.
26359372 2015 Aberrant expression and activity of histone deacetylases in sporadic idiopathic pulmonary fibrosis.
26305553 2015 Histone Deacetylase 3 and 4 Complex Stimulates the Transcriptional Activity of the Mineralocorticoid Receptor.
25997740 2015 miR-335 Targets SIAH2 and Confers Sensitivity to Anti-Cancer Drugs by Increasing the Expression of HDAC3.
25973054 2015 Increased HDAC3 and decreased miRNA-130a expression in PBMCs through recruitment HDAC3 in patients with spinal cord injuries.
More...