Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.42
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.59259147245065E-27
non-small cell lung cancer 2798 1.10033835448781E-15
nasopharyngeal carcinoma 1056 7.65217085964485E-9
osteosarcoma 7933 1.17105235950136E-7
ovarian cancer 8492 1.77092968458783E-7
lung adenocarcinoma 2714 2.03551055934544E-6
chronic lymphocytic leukemia 244 2.4532499309161E-5
tuberculosis 1563 8.11371535264754E-5
ulcerative colitis 2087 1.19793025576722E-4
interstitial cystitis 2299 3.70805919931185E-4
pancreatic cancer 2300 7.03876165131887E-4
chronic rhinosinusitis 512 0.00583863932061712
active Crohn's disease 918 0.0126972795926358
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0444136495154823

Expression

  Differential Expression (14)

Disease log2 FC p
chronic lymphocytic leukemia 1.141 0.000
osteosarcoma -1.878 0.000
tuberculosis 1.400 0.000
non-small cell lung cancer -1.548 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.044
active Crohn's disease -1.155 0.013
pancreatic cancer 1.300 0.001
interstitial cystitis -2.300 0.000
lung adenocarcinoma -1.500 0.000
nasopharyngeal carcinoma -1.600 0.000
lung carcinoma -1.300 0.000
ulcerative colitis -1.400 0.000
ovarian cancer -1.900 0.000
chronic rhinosinusitis -1.183 0.006

Synonym

Accession O15375 B4E288 MCT 6
Symbols MCT5
MCT6

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Gene RIF (1)

PMID Text
22911660 We demonstrated that SLC16A5 and ZNF206 displayed altered methylation patterns in the neuroblastoma genome

AA Sequence

MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLC      1 - 70
SILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLA     71 - 140
NALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPET    141 - 210
PALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISII    211 - 280
GFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIF    281 - 350
QVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQ    351 - 420
KKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKA    421 - 490
VLQAKQTALGWNSPT                                                           491 - 505
//

Text Mined References (9)

PMID Year Title
22911660 2013 Identification of aberrant methylation regions in neuroblastoma by screening of tissue-specific differentially methylated regions.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16174808 2005 Functional characterization of human monocarboxylate transporter 6 (SLC16A5).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10510291 1999 The proton-linked monocarboxylate transporter (MCT) family: structure, function and regulation.
9425115 1998 Cloning and sequencing of four new mammalian monocarboxylate transporter (MCT) homologues confirms the existence of a transporter family with an ancient past.